SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S ...   101   3e-22
At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) simi...   101   4e-22
At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ...    98   3e-21
At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063...    30   1.1  
At4g16095.1 68417.m02440 disease resistance protein-related cont...    29   1.5  
At4g23820.1 68417.m03425 glycoside hydrolase family 28 protein /...    28   4.5  
At3g54950.1 68416.m06092 patatin-related low similarity to patat...    28   4.5  
At3g24000.1 68416.m03014 pentatricopeptide (PPR) repeat-containi...    28   4.5  
At5g16500.1 68418.m01928 protein kinase family protein contains ...    27   7.8  
At2g02480.1 68415.m00187 DNA polymerase-related weak similarity ...    27   7.8  

>At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S
           RIBOSOMAL PROTEIN S19 - Oryza sativa,
           SWISSPROT:RS19_ORYSA
          Length = 143

 Score =  101 bits (242), Expect = 3e-22
 Identities = 43/87 (49%), Positives = 61/87 (70%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y+R A++ R IY+R  +GV    +I+GG KRNG  P HFC+SSG IAR  LQ LE + 
Sbjct: 53  WYYIRAASMARKIYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMS 112

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VE    GGR +T+ G+RDLD++A ++
Sbjct: 113 IVELDTKGGRRITSSGQRDLDQVAGRI 139



 Score = 61.7 bits (143), Expect = 3e-10
 Identities = 27/46 (58%), Positives = 34/46 (73%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TVKDV     VK  A+HLK++GK+++P   D+VKT R KELAPYDP
Sbjct: 6   TVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDP 51


>At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) similar
           to 40S ribosomal protein S19 GB:P40978 [Oryza sativa]
          Length = 143

 Score =  101 bits (241), Expect = 4e-22
 Identities = 42/87 (48%), Positives = 61/87 (70%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y+R A++ R +Y+R  +GV    +I+GG KRNG  P HFC+SSG IAR  LQ LE + 
Sbjct: 53  WYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMN 112

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VE    GGR +T+ G+RDLD++A ++
Sbjct: 113 IVELDTKGGRRITSSGQRDLDQVAGRI 139



 Score = 61.3 bits (142), Expect = 4e-10
 Identities = 26/46 (56%), Positives = 34/46 (73%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TVKDV     VK  A+HLK++GK+++P   D+VKT + KELAPYDP
Sbjct: 6   TVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDP 51


>At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S
           ribsomal protein S19, Oryza sativa, SWISSPROT:RS19_ORYSA
          Length = 143

 Score = 98.3 bits (234), Expect = 3e-21
 Identities = 39/87 (44%), Positives = 61/87 (70%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y+R A++ R +Y+R  +GV    +I+GG KRNG  P HFC+SSG +AR  LQ L+ + 
Sbjct: 53  WYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGVARHILQQLQTMN 112

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +V+    GGR +T+ G+RDLD++A ++
Sbjct: 113 IVDLDTKGGRKITSSGQRDLDQVAGRI 139



 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TVKDV   + VK  AAHLK++GK+++P   D+VKT + KELAPYDP
Sbjct: 6   TVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDP 51


>At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063:
           Domain of unknown function (DUF383) and  PF04064: Domain
           of unknown function (DUF384)
          Length = 339

 Score = 29.9 bits (64), Expect = 1.1
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +3

Query: 309 FCRSSGSIARKALQSLEALKL-VEKVQDGGRILTTQGRRDLDRIAAQ 446
           FCRSSG  A    + + ++ + + K +DG ++L    RR L +I  Q
Sbjct: 143 FCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLLKQIIRQ 189


>At4g16095.1 68417.m02440 disease resistance protein-related
           contains weak similarity to rpp8 [Arabidopsis thaliana]
           gi|3901294|gb|AAC78631
          Length = 187

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 10/25 (40%), Positives = 13/25 (52%)
 Frame = -3

Query: 393 HRPELSQQASMPPTIAKPCVQYCLM 319
           H P L  Q   PP +   C++YC M
Sbjct: 86  HMPRLPDQHRFPPNLTNICLRYCCM 110


>At4g23820.1 68417.m03425 glycoside hydrolase family 28 protein /
           polygalacturonase (pectinase) family protein weak
           similarity to polygalacturonase PG1 [Glycine max]
           GI:5669846; contains PF00295: Glycosyl hydrolases family
           28
          Length = 444

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -2

Query: 328 LPDDLQKCEGVTPLRLRPPKILVTVFTPTGE 236
           L D    C G+ PLR R  KI +T F   G+
Sbjct: 21  LGDSEATCSGIVPLRYRYDKISITDFGGVGD 51


>At3g54950.1 68416.m06092 patatin-related low similarity to patatin
           [GI:169500][Solanum tuberosum]; contains Patatin domain
           PF01734
          Length = 488

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = -3

Query: 228 KYDEGWQHNAHRTNXGSYG-ASSLKRAVFTRS-MCSGTLTLPVFFK*AATVLTI 73
           K D+ WQ    R   G YG A  LKR + T S  CSGT  L    K + + LT+
Sbjct: 167 KADDTWQFLT-RNAKGLYGGAGILKRVLRTGSGCCSGTAKLKKVMKESFSELTL 219


>At3g24000.1 68416.m03014 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 633

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%)
 Frame = +3

Query: 246 GVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVE--KVQDGGRILTTQGR 419
           G +   ++F G  R+G  PSHF  +S   A  +   LE  K V    ++ G +++   G 
Sbjct: 242 GTEKALELFQGMLRDGFRPSHFSYASLFGACSSTGFLEQGKWVHAYMIKSGEKLVAFAGN 301

Query: 420 RDLDRIA 440
             LD  A
Sbjct: 302 TLLDMYA 308


>At5g16500.1 68418.m01928 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 636

 Score = 27.1 bits (57), Expect = 7.8
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 56  DVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELA 172
           +VE D+    V A  K+T + +  E    VKT  F+ELA
Sbjct: 30  NVEHDEFRPPVVATTKRTEEREPAEQQPPVKTFNFRELA 68


>At2g02480.1 68415.m00187 DNA polymerase-related weak similarity to
           DNA polymerase III holoenzyme tau subunit [Thermus
           thermophilus] GI:2583049
          Length = 1218

 Score = 27.1 bits (57), Expect = 7.8
 Identities = 15/52 (28%), Positives = 24/52 (46%)
 Frame = -2

Query: 433 LSRSRLPCVVRMRXXXXXXXXXFNASNDCKALRAILPDDLQKCEGVTPLRLR 278
           +S SRL C+ + +          NA +D         +DL+K  G +PL L+
Sbjct: 178 ISSSRLDCLSKYQPRDDIVARNCNAGSDDTEEELSNSEDLRKVTGASPLLLK 229


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,942,247
Number of Sequences: 28952
Number of extensions: 216557
Number of successful extensions: 483
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 475
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 483
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 977150592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -