SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A21
         (651 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g07070.1 68416.m00840 protein kinase family protein contains ...    30   1.5  
At5g18610.1 68418.m02203 protein kinase family protein contains ...    29   2.7  
At5g02800.1 68418.m00222 protein kinase family protein contains ...    29   2.7  
At3g24790.1 68416.m03111 protein kinase family protein contains ...    29   3.5  
At5g13160.1 68418.m01507 protein kinase family protein contains ...    27   8.2  
At3g26940.1 68416.m03373 protein kinase family protein contains ...    27   8.2  

>At3g07070.1 68416.m00840 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 414

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRR 243
           G++EF+++ + L  LHH HL+NL      G++R
Sbjct: 117 GNKEFIVEVLMLSLLHHKHLVNLIGYCADGDQR 149


>At5g18610.1 68418.m02203 protein kinase family protein contains
           eukaryotic protein kinase domain, PROSITE:PS00107
          Length = 513

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRRSSRLSYHP 219
           G+ EFL++ + L  LHH +L+NL      G++R     Y P
Sbjct: 121 GNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMP 161


>At5g02800.1 68418.m00222 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 378

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRRSSRLSYHP 219
           G+ EFL++ + L  LHH +L+NL      G++R     Y P
Sbjct: 111 GNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMP 151


>At3g24790.1 68416.m03111 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 379

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRRSSRLSYHP 219
           G  EFL++ + L  LHH +L+NL      G++R     Y P
Sbjct: 101 GQREFLVEVLMLSLLHHRNLVNLIGYCADGDQRLLVYEYMP 141


>At5g13160.1 68418.m01507 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 456

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRR 243
           G+ EFL++ + L  LHH +L+NL      G++R
Sbjct: 124 GNREFLVEVLMLSLLHHPNLVNLIGYCADGDQR 156


>At3g26940.1 68416.m03373 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 432

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRRSSRLSYHP 219
           G +EFL++ + L  LHH +L++L      G++R     Y P
Sbjct: 111 GDKEFLVEVLMLSLLHHRNLVHLFGYCAEGDQRLVVYEYMP 151


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,173,365
Number of Sequences: 28952
Number of extensions: 133462
Number of successful extensions: 285
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 280
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 285
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -