SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g01290.1 68414.m00045 molybdopterin biosynthesis CNX3 protein...    30   1.3  
At3g02930.1 68416.m00288 expressed protein  ; expression support...    29   1.8  
At3g43540.2 68416.m04623 expressed protein hypothetical protein ...    29   2.4  
At3g43540.1 68416.m04622 expressed protein hypothetical protein ...    29   2.4  
At4g25120.1 68417.m03614 UvrD/REP helicase family protein contai...    28   5.4  
At3g19830.1 68416.m02512 C2 domain-containing protein low simila...    27   9.5  
At1g50260.1 68414.m05635 C2 domain-containing protein low simila...    27   9.5  

>At1g01290.1 68414.m00045 molybdopterin biosynthesis CNX3 protein /
           molybdenum cofactor biosynthesis enzyme CNX3 (CNX3)
           identical to molybdopterin biosynthesis CNX3 protein
           SP|Q39056 from [Arabidopsis thaliana]
          Length = 270

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 18/85 (21%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +1

Query: 136 PQSVSVDQMRQILNEIIDALESPDYASKLDEAK-EAAGNEMLKMMQIVFPMVVQIEMETI 312
           PQ ++++++ Q +  I     SPD    +D ++ +++  E L+   I F   ++    T 
Sbjct: 35  PQIMNINELNQEMQSIFGQEPSPDGPGTMDFSELKSSKIEPLRSKNIDFRQQIEYHKST- 93

Query: 313 KHHGFNNSREGIVQFTQLIRDLESI 387
             H   N  + I Q+ ++  D+  +
Sbjct: 94  --HSSKNDSQAIEQYAKVASDMSKL 116


>At3g02930.1 68416.m00288 expressed protein  ; expression supported
           by MPSS
          Length = 806

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +1

Query: 130 SSPQSVSVDQMRQILNEIIDALESPDYASKLDEAKEA 240
           S PQSV + +  +  NE+I +LE+ + A  LD+ KEA
Sbjct: 85  SQPQSVQIKEDLKKANELIASLEN-EKAKALDQLKEA 120


>At3g43540.2 68416.m04623 expressed protein hypothetical protein
           slr1699 - Synechocystis sp. (strain PCC 6803),
           PIR:S75306
          Length = 301

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +1

Query: 286 VVQIEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIR 423
           V+++ ++T      NN +E +  FT+L+  L S+ GEV +  ++ R
Sbjct: 147 VLKLLLDTAGTTILNNDQEALKSFTKLVDQLPSVFGEVGQGVSEFR 192


>At3g43540.1 68416.m04622 expressed protein hypothetical protein
           slr1699 - Synechocystis sp. (strain PCC 6803),
           PIR:S75306
          Length = 373

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +1

Query: 286 VVQIEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIR 423
           V+++ ++T      NN +E +  FT+L+  L S+ GEV +  ++ R
Sbjct: 219 VLKLLLDTAGTTILNNDQEALKSFTKLVDQLPSVFGEVGQGVSEFR 264


>At4g25120.1 68417.m03614 UvrD/REP helicase family protein contains
            Pfam PF00580: UvrD/REP helicase
          Length = 1122

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +1

Query: 187  DALESP-DYASKLDEAKEAA-GNEMLKMMQIVFPMVVQIEMETIKHHGFNN--SREGIVQ 354
            D +  P DYAS+   A  A  GN  LK  +   P    +E+ ++  H F+N   ++   +
Sbjct: 948  DVMNIPEDYASEESIAAYALNGNNFLKRCRTFIPNRFDVEVRSVVSHLFHNWAKKQAFQE 1007

Query: 355  FTQLIRDLESIDGE 396
              +LI  +  + GE
Sbjct: 1008 PKRLIDKVRFVIGE 1021


>At3g19830.1 68416.m02512 C2 domain-containing protein low
           similarity to GLUT4 vesicle protein [Rattus norvegicus]
           GI:4193489; contains Pfam profile PF00168: C2 domain
          Length = 666

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 10/35 (28%), Positives = 21/35 (60%)
 Frame = +1

Query: 169 ILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQI 273
           +L  +ID L+ PDY  +++  + + G+E L +  +
Sbjct: 229 LLQPVIDDLKKPDYVQRVEIKQFSLGDEPLSVRNV 263


>At1g50260.1 68414.m05635 C2 domain-containing protein low
           similarity to CLB1 [Lycopersicon esculentum] GI:2789434;
           contains Pfam profile PF00168: C2 domain
          Length = 675

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 10/35 (28%), Positives = 21/35 (60%)
 Frame = +1

Query: 169 ILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQI 273
           +L  +ID L+ PDY  +++  + + G+E L +  +
Sbjct: 217 LLQPVIDDLKKPDYVQRVEIKQFSLGDEPLSVRNV 251


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,178,091
Number of Sequences: 28952
Number of extensions: 239368
Number of successful extensions: 686
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 662
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 686
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1187288784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -