SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) iden...   119   9e-28
At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) simi...   117   4e-27
At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) simi...   116   6e-27
At3g56240.1 68416.m06250 copper homeostasis factor / copper chap...    28   3.8  
At1g48740.1 68414.m05454 expressed protein                             28   3.8  
At4g22260.1 68417.m03220 alternative oxidase, putative / immutan...    27   6.7  
At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id...    27   6.7  
At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera...    27   6.7  
At1g28320.1 68414.m03475 protease-related similar to Protease de...    27   8.9  

>At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A)
           identical to GB:Q42351, location of EST 105E2T7,
           gb|T22624
          Length = 120

 Score =  119 bits (287), Expect = 9e-28
 Identities = 60/104 (57%), Positives = 74/104 (71%), Gaps = 2/104 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRL +R R SY TKSNQ RIV+TPGG+LVYQ  KK    P+C     +++GI   RP+
Sbjct: 1   MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS 60

Query: 211 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E  RSRL   ++TV R YGGVL    V++RI+RAFL+EEQKIVK
Sbjct: 61  EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104


>At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) similar
           to SP:Q42351 from [Arabidopsis thaliana]
          Length = 119

 Score =  117 bits (282), Expect = 4e-27
 Identities = 59/104 (56%), Positives = 72/104 (69%), Gaps = 2/104 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRL +R R SY TKSNQ RIV+TPGG+L YQ  KK    P+C     +++GI   RP 
Sbjct: 1   MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPT 60

Query: 211 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E  RSRL   ++TV R YGGVL    V++RI+RAFL+EEQKIVK
Sbjct: 61  EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104


>At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) similar
           to 60S ribosomal protein L34 GB:P41098 [Nicotiana
           tabacum]
          Length = 120

 Score =  116 bits (280), Expect = 6e-27
 Identities = 60/104 (57%), Positives = 72/104 (69%), Gaps = 2/104 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRL +R R SY TKSNQ RIV+TPGG+L YQ   K    P+C     +++GI   RPA
Sbjct: 1   MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA 60

Query: 211 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E  RSRL   ++TV R YGGVL    V++RIVRAFL+EEQKIVK
Sbjct: 61  EYKRSRLARNERTVNRAYGGVLSGVAVRERIVRAFLVEEQKIVK 104


>At3g56240.1 68416.m06250 copper homeostasis factor / copper
           chaperone (CCH) (ATX1) identical to gi:3168840 Pfam
           profile PF00403: Heavy-metal-associated domain
          Length = 121

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +3

Query: 84  SKKNSKDTGWPLGLSVCKKAQEDPKVWSVQE 176
           SK   K + WP+      KA+ DPKV +V E
Sbjct: 58  SKTGKKTSYWPVEAEAEPKAEADPKVETVTE 88


>At1g48740.1 68414.m05454 expressed protein
          Length = 393

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%)
 Frame = +1

Query: 46  TFRRRLSYNTKSNQRRIVRTP-GGRLVYQ 129
           +FR+ +S NTK + RRI+  P  G LV+Q
Sbjct: 130 SFRKAISENTKESFRRIISEPFPGVLVFQ 158


>At4g22260.1 68417.m03220 alternative oxidase, putative / immutans
           protein (IM) identical to IMMUTANS from Arabidopsis
           thaliana [gi:4138855]; contains Pfam profile PF01786
           alternative oxidase
          Length = 351

 Score = 27.1 bits (57), Expect = 6.7
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = -2

Query: 339 DLHNFLFFNEEGSDNALLDTFMAEDTTINTFHCFLTV 229
           ++H+ L   E G ++   D F+A+   I TF+ F+TV
Sbjct: 175 EMHHLLIMEELGGNSWWFDRFLAQH--IATFYYFMTV 209


>At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly
            identical to auxin transport protein; BIG [Arabidopsis
            thaliana] GI:21779966; contains Pfam profiles PF02207:
            Putative zinc finger in N-recognin, PF00569: Zinc finger
            ZZ type
          Length = 5098

 Score = 27.1 bits (57), Expect = 6.7
 Identities = 10/36 (27%), Positives = 20/36 (55%)
 Frame = -2

Query: 201  SWLDTTEFALALTTPWDLLGLFYILINQAATRCPYY 94
            SWLD    A  L   +D++G+   ++++  T+C  +
Sbjct: 5055 SWLDEINSATDLQEAFDIVGVLADVLSEGVTQCDQF 5090


>At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 496

 Score = 27.1 bits (57), Expect = 6.7
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = -3

Query: 221 RERSAGLAGWIPRSLLLH*PHLGIFL 144
           +ERS  + GW P+ L+L  P +G FL
Sbjct: 347 KERSLLIKGWSPQMLILSHPAVGGFL 372


>At1g28320.1 68414.m03475 protease-related similar to Protease degS
           [Precursor] (SP:P44947) [Haemophilus influenzae];
           similar to DegP protease precursor (GI:2565436)
           [Arabidopsis thaliana]
          Length = 709

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +3

Query: 54  ATTVVQHKIKSKKNSKDTGWPLGLSVCKKA 143
           ++  +Q  I++   SKD+GW +G S+   A
Sbjct: 141 SSAALQSLIEASSGSKDSGWDIGWSLVSAA 170


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,718,335
Number of Sequences: 28952
Number of extensions: 182360
Number of successful extensions: 509
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 495
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 506
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 838967680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -