SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g51190.1 68416.m05604 60S ribosomal protein L8 (RPL8B) riboso...   270   5e-73
At2g18020.1 68415.m02094 60S ribosomal protein L8 (RPL8A)             270   7e-73
At4g36130.1 68417.m05142 60S ribosomal protein L8 (RPL8C) riboso...   269   1e-72
At2g44065.2 68415.m05480 ribosomal protein L2 family protein sim...    57   9e-09
At2g44065.1 68415.m05479 ribosomal protein L2 family protein sim...    57   9e-09
At4g14250.1 68417.m02198 UBX domain-containing protein low simil...    32   0.29 
At3g27500.1 68416.m03438 DC1 domain-containing protein contains ...    32   0.29 
At4g00450.1 68417.m00062 expressed protein                             30   1.6  
At5g20860.1 68418.m02477 pectinesterase family protein contains ...    29   3.6  
At3g12000.1 68416.m01486 S-locus related protein SLR1, putative ...    29   3.6  
At5g65290.1 68418.m08212 LMBR1 integral membrane family protein ...    28   4.8  
At4g33410.1 68417.m04748 signal peptide peptidase family protein...    27   8.3  
At3g16950.1 68416.m02166 dihydrolipoamide dehydrogenase 1, plast...    27   8.3  
At2g22730.1 68415.m02694 transporter-related low similarity to s...    27   8.3  

>At3g51190.1 68416.m05604 60S ribosomal protein L8 (RPL8B) ribosomal
           protein L8, cytosolic - Arabidopsis thaliana, PIR:T04582
          Length = 260

 Score =  270 bits (662), Expect = 5e-73
 Identities = 120/184 (65%), Positives = 150/184 (81%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A   F    Y ER+GY+KG+V +IIHDPGRGAPLA V FR P+++  +KELF+A E
Sbjct: 24  RKGPA--KFRSLDYGERNGYLKGLVTEIIHDPGRGAPLARVAFRHPFRYMKQKELFVAAE 81

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQ++YCGKKA L VGNV+P+G++PEG ++CN+E  +GDRG LARASG++A VI HN
Sbjct: 82  GMYTGQYLYCGKKANLMVGNVLPLGSIPEGAVICNVELHVGDRGALARASGDYAIVIAHN 141

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P++  TRVKLPSG+KK+LPS+ R M+G VAGGGR +KP LKAG AYHKYK KRNCWP VR
Sbjct: 142 PESNTTRVKLPSGSKKILPSACRAMIGQVAGGGRTEKPFLKAGNAYHKYKAKRNCWPVVR 201

Query: 645 GVAM 656
           GVAM
Sbjct: 202 GVAM 205



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 20/27 (74%), Positives = 20/27 (74%), Gaps = 1/27 (3%)
 Frame = +2

Query: 62  AQRKGA-GSVFVSHTKKRKGAPKLRSL 139
           AQRKGA GSVF SHT  RKG  K RSL
Sbjct: 7   AQRKGAAGSVFKSHTHHRKGPAKFRSL 33


>At2g18020.1 68415.m02094 60S ribosomal protein L8 (RPL8A) 
          Length = 258

 Score =  270 bits (661), Expect = 7e-73
 Identities = 122/184 (66%), Positives = 151/184 (82%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A   F    + ER+GY+KGVV +IIHDPGRGAPLA V FR P++FK +KELF+A E
Sbjct: 23  RKGPA--KFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVTFRHPFRFKKQKELFVAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQF+YCGKKATL VGNV+P+ ++PEG +VCN+E  +GDRG LARASG++A VI HN
Sbjct: 81  GMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHVGDRGVLARASGDYAIVIAHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           PD+  TR+KLPSG+KK++PS  R M+G VAGGGR +KP+LKAG AYHKY+VKRN WP VR
Sbjct: 141 PDSDTTRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNSWPKVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/26 (76%), Positives = 20/26 (76%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF SHT  RKG  K RSL
Sbjct: 7   AQRKGAGSVFKSHTHHRKGPAKFRSL 32


>At4g36130.1 68417.m05142 60S ribosomal protein L8 (RPL8C) ribosomal
           protein L8, cytosolic, tomato, PIR1:R5TOL8
          Length = 258

 Score =  269 bits (659), Expect = 1e-72
 Identities = 120/184 (65%), Positives = 150/184 (81%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A   F    + ER+GY+KGVV +IIHDPGRGAPLA V FR P++FK +KELF+A E
Sbjct: 23  RKGPA--KFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVAFRHPFRFKKQKELFVAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQF+YCGKKATL VGNV+P+ ++PEG ++CN+E  +GDRG  ARASG++A VI HN
Sbjct: 81  GMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVICNVEHHVGDRGVFARASGDYAIVIAHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           PD   +R+KLPSG+KK++PS  R M+G VAGGGR +KP+LKAG AYHKY+VKRNCWP VR
Sbjct: 141 PDNDTSRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/26 (76%), Positives = 20/26 (76%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF SHT  RKG  K RSL
Sbjct: 7   AQRKGAGSVFKSHTHHRKGPAKFRSL 32


>At2g44065.2 68415.m05480 ribosomal protein L2 family protein
           similar to ribosomal protein L2 [Gossypium arboreum]
           GI:17644114; contains Pfam profile  PF03947: Ribosomal
           Proteins L2, C-terminal domain
          Length = 214

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 37/107 (34%), Positives = 58/107 (54%)
 Frame = +3

Query: 336 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           +G+ MP+G M  GTI+ N+E   G   ++ RA+G  A ++   P   +  +KLPSG  K 
Sbjct: 59  IGSSMPLGMMRIGTIIHNIEMNPGQGAKMVRAAGTNAKIL-KEPAKGKCLIKLPSGDTKW 117

Query: 516 LPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + +  R  +G V+      K + KAG++  ++   R   P VRGVAM
Sbjct: 118 INAKCRATIGTVSNPSHGTKKLYKAGQS--RWLGIR---PKVRGVAM 159


>At2g44065.1 68415.m05479 ribosomal protein L2 family protein
           similar to ribosomal protein L2 [Gossypium arboreum]
           GI:17644114; contains Pfam profile  PF03947: Ribosomal
           Proteins L2, C-terminal domain
          Length = 214

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 37/107 (34%), Positives = 58/107 (54%)
 Frame = +3

Query: 336 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           +G+ MP+G M  GTI+ N+E   G   ++ RA+G  A ++   P   +  +KLPSG  K 
Sbjct: 59  IGSSMPLGMMRIGTIIHNIEMNPGQGAKMVRAAGTNAKIL-KEPAKGKCLIKLPSGDTKW 117

Query: 516 LPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + +  R  +G V+      K + KAG++  ++   R   P VRGVAM
Sbjct: 118 INAKCRATIGTVSNPSHGTKKLYKAGQS--RWLGIR---PKVRGVAM 159


>At4g14250.1 68417.m02198 UBX domain-containing protein low
           similarity to 60S ribosomal protein L2 [Nicotiana
           tabacum] GI:9230281; contains Pfam profile PF00789: UBX
           domain
          Length = 724

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +3

Query: 486 VKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + LP  +KK + S  R M+G +A  G     + K      K  +KRN W  VRGVAM
Sbjct: 382 INLPLDSKKTVLSGCRVMIGQIASSG-----LTK------KLMIKRNMWAKVRGVAM 427


>At3g27500.1 68416.m03438 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 609

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = -1

Query: 395 FKIAHNGTLRHSSNRH-HISNFKSCFLSTINKLACVEPFGSNEELLPCLELVWI 237
           FK   + T+ H S+RH H+S  K    S+  K AC  P GS+  L  C E  +I
Sbjct: 363 FKRNDDNTIDHFSHRHNHMSLDKGGEESSFCK-ACAHPIGSSSSLYKCSECSFI 415


>At4g00450.1 68417.m00062 expressed protein
          Length = 2124

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 18/79 (22%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = -1

Query: 407  THFLFKIAHNGTLRHSSNRHHISNFKSCFLSTINKLACV-EPFGSNEELLPCLELVWIAE 231
            TH+L K+   GT++ S    +   ++      +  + C+ +  G+ +E  P L    ++ 
Sbjct: 1149 THYLKKLIGTGTMKASLAEKNDDGYQVAQQIVVGLMDCIRQTGGAAQEGDPSLVSSAVSA 1208

Query: 230  VYNSQRCTSTRVMDYILNN 174
            + NS   +  R+ D+ L N
Sbjct: 1209 IINSVGLSVARITDFSLGN 1227


>At5g20860.1 68418.m02477 pectinesterase family protein contains
           Pfam profile: PF01095 pectinesterase
          Length = 512

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 20/92 (21%), Positives = 37/92 (40%), Gaps = 4/92 (4%)
 Frame = +3

Query: 342 NVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLP----SGAK 509
           +++  G     + + ++ +KM    RL   S      I  NP  K     LP    +G +
Sbjct: 160 SILDSGGSSSASAISHISQKMDHLSRLVSNSLTLVDTIMKNPKPKTKSTALPRWVTAGER 219

Query: 510 KVLPSSNRGMVGIVAGGGRIDKPILKAGRAYH 605
           ++L    R  V +   G    + +++A  A H
Sbjct: 220 RLLVGRARAHVVVAKDGSGDYRTVMEAVTAAH 251


>At3g12000.1 68416.m01486 S-locus related protein SLR1, putative
           (S1) identical to S-locus related protein SLR1 homolog
           (AtS1) GI:246209 Arabidopsis thaliana]; contains Pfam
           profiles PF01453: Lectin (probable mannose binding),
           PF00954: S-locus glycoprotein family
          Length = 439

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 2/86 (2%)
 Frame = -1

Query: 605 VVCPSS-FQNRFVNTSTSSNNTDHASVA*WQNLLGSRR*LYSCTLSIRIVSNHSGEVSRG 429
           +V P + F+  F  T+TSS N DH  +  W   +  R  ++        V+N    +S+ 
Sbjct: 49  IVSPGNIFELGFFKTTTSSRNGDHWYLGIWYKSISERTYVW--------VANRDNPLSK- 99

Query: 428 TCQTTSITHF-LFKIAHNGTLRHSSN 354
           +  T  I++  L  + H+GTL  S+N
Sbjct: 100 SIGTLKISYANLVLLDHSGTLVWSTN 125


>At5g65290.1 68418.m08212 LMBR1 integral membrane family protein
           contains Pfam PF04791: LMBR1-like conserved region
          Length = 733

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 8/21 (38%), Positives = 13/21 (61%)
 Frame = +2

Query: 554 WRWTY*QTYFESWKGIPQVQG 616
           W W+Y  T+  +W  +P +QG
Sbjct: 74  WSWSYWSTFLLTWAVVPLIQG 94


>At4g33410.1 68417.m04748 signal peptide peptidase family protein
           contains Pfam domain PF04258: Membrane protein of
           unknown function (DUF435)
          Length = 372

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = -2

Query: 610 YLWYALPAFKIGL 572
           Y+WYALP + IGL
Sbjct: 301 YIWYALPGYAIGL 313


>At3g16950.1 68416.m02166 dihydrolipoamide dehydrogenase 1,
           plastidic / lipoamide dehydrogenase 1 (PTLPD1) identical
           to plastidic lipoamide dehydrogenase from Arabidopsis
           thaliana [gi:7159282]
          Length = 570

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = -1

Query: 446 GEVSRGTCQTTSITHFLFKIAHNGTLRHSSNRHHISNF 333
           G+V  GTC           +A +G +R   N HH+ +F
Sbjct: 117 GDVVGGTCVNRGCVPSKALLAVSGRMRELQNEHHMKSF 154


>At2g22730.1 68415.m02694 transporter-related low similarity to
           spinster membrane proteins from [Drosophila
           melanogaster] GI:12003974, GI:12003976, GI:12003972,
           GI:12003970; contains Pfam profile PF00083: major
           facilitator superfamily protein
          Length = 510

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 24/79 (30%), Positives = 31/79 (39%)
 Frame = -2

Query: 553 ATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARRPLSPIFSSRLHTMV 374
           ATIP    LL G TFL     FT   L S    I +    E       +P+    LH + 
Sbjct: 361 ATIPNAFKLLSGATFLGAVFCFTAFTLKSLYGFIALFALGELLVFATQAPVNYVCLHCVK 420

Query: 373 PSGIAPTGITFPTSRVAFF 317
           PS + P  +   T  +  F
Sbjct: 421 PS-LRPLSMAISTVAIHIF 438


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,244,466
Number of Sequences: 28952
Number of extensions: 335399
Number of successful extensions: 907
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 876
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 905
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1373722560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -