SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g15280.1 68418.m01790 pentatricopeptide (PPR) repeat-containi...    34   0.072
At5g10470.1 68418.m01213 kinesin motor protein-related TH65 prot...    33   0.22 
At1g51690.2 68414.m05825 serine/threonine protein phosphatase 2A...    31   0.88 
At1g51690.1 68414.m05824 serine/threonine protein phosphatase 2A...    31   0.88 
At1g32160.1 68414.m03956 expressed protein                             29   2.0  
At1g17720.2 68414.m02194 serine/threonine protein phosphatase 2A...    29   2.7  
At1g17720.1 68414.m02193 serine/threonine protein phosphatase 2A...    29   2.7  
At5g65460.1 68418.m08232 kinesin motor protein-related contains ...    28   4.7  
At3g51050.1 68416.m05590 FG-GAP repeat-containing protein              28   6.2  
At3g01760.1 68416.m00114 lysine and histidine specific transport...    28   6.2  
At2g26140.1 68415.m03137 FtsH protease, putative contains simila...    28   6.2  
At5g45770.1 68418.m05627 leucine-rich repeat family protein cont...    27   8.2  
At1g31470.1 68414.m03853 nodulin-related weak similarity to nodu...    27   8.2  

>At5g15280.1 68418.m01790 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 1227

 Score = 34.3 bits (75), Expect = 0.072
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = +2

Query: 374 ELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPE---KDYKINIYNFN 514
           EL + G+++D V      G+C +E + K A LY+ E   K YK ++Y++N
Sbjct: 348 ELEHLGFKQDEVTFGILIGWCCYEGDIKRAVLYLSEIMSKGYKPDVYSYN 397


>At5g10470.1 68418.m01213 kinesin motor protein-related TH65
           protein, Arabidopsis thaliana, EMBL:AJ001729; contains
           Pfam profile PF00225: Kinesin motor domain
          Length = 1273

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 2/82 (2%)
 Frame = +2

Query: 260 QTNRVQQKIQVGQAPILHLIHTDSHLITQ--EKGGKLKVFELTNSGYEEDAVIEVDYPGF 433
           ++ ++ Q +   +A I  LI+    L        G +KVF      +E++    +++PG 
Sbjct: 107 KSRKLDQFVLETEARISPLINEKKRLFNDLLTAKGNIKVFCRARPLFEDEGPSVIEFPGD 166

Query: 434 CRFEANTKLASLYVPEKDYKIN 499
           C    NT   +L  P+KD++ +
Sbjct: 167 CTICVNTSDDTLSNPKKDFEFD 188


>At1g51690.2 68414.m05825 serine/threonine protein phosphatase 2A
           (PP2A) 55 kDa regulatory subunit B identical to 55 kDa B
           regulatory subunit of phosphatase 2A (GI:710330)
           [Arabidopsis thaliana]; similar to type 2A protein
           serine/threonine phosphatase 55 kDa B regulatory
           GI:1408460 [Arabidopsis thaliana]; contains Pfam
           PF00400: WD domain, G-beta repeat (5 copies, 3 weak)
          Length = 512

 Score = 30.7 bits (66), Expect = 0.88
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 7/75 (9%)
 Frame = +2

Query: 287 QVGQAPILHLIHTDS---HLITQEKGGKLKVFELT---NSGYEEDAVIEVDYP-GFCRFE 445
           +V +  I+  I  D+   HL T ++GG++ +FE T   NS      + E DYP     F 
Sbjct: 34  EVQEVDIISAIEFDNSGNHLATGDRGGRVVLFERTDTNNSSGTRRELEEADYPLRHPEFR 93

Query: 446 ANTKLASLYVPEKDY 490
             T+  S + PE DY
Sbjct: 94  YKTEFQS-HDPEFDY 107


>At1g51690.1 68414.m05824 serine/threonine protein phosphatase 2A
           (PP2A) 55 kDa regulatory subunit B identical to 55 kDa B
           regulatory subunit of phosphatase 2A (GI:710330)
           [Arabidopsis thaliana]; similar to type 2A protein
           serine/threonine phosphatase 55 kDa B regulatory
           GI:1408460 [Arabidopsis thaliana]; contains Pfam
           PF00400: WD domain, G-beta repeat (5 copies, 3 weak)
          Length = 513

 Score = 30.7 bits (66), Expect = 0.88
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 7/75 (9%)
 Frame = +2

Query: 287 QVGQAPILHLIHTDS---HLITQEKGGKLKVFELT---NSGYEEDAVIEVDYP-GFCRFE 445
           +V +  I+  I  D+   HL T ++GG++ +FE T   NS      + E DYP     F 
Sbjct: 34  EVQEVDIISAIEFDNSGNHLATGDRGGRVVLFERTDTNNSSGTRRELEEADYPLRHPEFR 93

Query: 446 ANTKLASLYVPEKDY 490
             T+  S + PE DY
Sbjct: 94  YKTEFQS-HDPEFDY 107


>At1g32160.1 68414.m03956 expressed protein
          Length = 406

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = -3

Query: 609 GLSHGNSMNFRHITSPSFTDASSYSKEPSFSPLKL*MFIL 490
           G SHG  + F H  S SF+   S S  PS  P +   F +
Sbjct: 5   GSSHGRRLCFNHYLSDSFSKFLSPSSSPSLLPQRCHSFCI 44


>At1g17720.2 68414.m02194 serine/threonine protein phosphatase 2A
           (PP2A) 55 kDa regulatory subunit B identical to type 2A
           protein serine/threonine phosphatase 55 kDa B regulatory
           subunit (GI:1408460) [Arabidopsis thaliana]; similar to
           55 kDa B regulatory subunit of phosphatase 2A GI:710330;
           contains Pfam PF00400: WD domain, G-beta repeat (5
           copies, 3 weak)
          Length = 500

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 7/75 (9%)
 Frame = +2

Query: 287 QVGQAPILHLIHTDS---HLITQEKGGKLKVFELTNS---GYEEDAVIEVDYP-GFCRFE 445
           +V +  I+  I  D    HL T ++GG++ +FE T++   G     + + DYP     F 
Sbjct: 32  EVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTKDHGGSRKDLEQTDYPVRHPEFR 91

Query: 446 ANTKLASLYVPEKDY 490
             T+  S + PE DY
Sbjct: 92  YKTEFQS-HEPEFDY 105


>At1g17720.1 68414.m02193 serine/threonine protein phosphatase 2A
           (PP2A) 55 kDa regulatory subunit B identical to type 2A
           protein serine/threonine phosphatase 55 kDa B regulatory
           subunit (GI:1408460) [Arabidopsis thaliana]; similar to
           55 kDa B regulatory subunit of phosphatase 2A GI:710330;
           contains Pfam PF00400: WD domain, G-beta repeat (5
           copies, 3 weak)
          Length = 501

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 7/75 (9%)
 Frame = +2

Query: 287 QVGQAPILHLIHTDS---HLITQEKGGKLKVFELTNS---GYEEDAVIEVDYP-GFCRFE 445
           +V +  I+  I  D    HL T ++GG++ +FE T++   G     + + DYP     F 
Sbjct: 32  EVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTKDHGGSRKDLEQTDYPVRHPEFR 91

Query: 446 ANTKLASLYVPEKDY 490
             T+  S + PE DY
Sbjct: 92  YKTEFQS-HEPEFDY 105


>At5g65460.1 68418.m08232 kinesin motor protein-related contains
           similarity to kinesin heavy chain
          Length = 1281

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +2

Query: 356 GKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKDYKIN 499
           G +KVF      +E++    +++P  C    NT   +L  P+K+++ +
Sbjct: 137 GNVKVFCRARPLFEDEGPSIIEFPDNCTIRVNTSDDTLSNPKKEFEFD 184


>At3g51050.1 68416.m05590 FG-GAP repeat-containing protein
          Length = 698

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +2

Query: 443 EANTKLASLYVPEKDYKINIYNFNGEKLGSLE 538
           EA+T  AS  +P+ +YK++++  N    G  E
Sbjct: 260 EAHTSDASQLIPQHNYKLDVHALNSRHPGEFE 291


>At3g01760.1 68416.m00114 lysine and histidine specific transporter,
           putative similar to lysine and histidine specific
           transporter [Arabidopsis thaliana] GI:2576361; contains
           Pfam profile PF01490: Transmembrane amino acid
           transporter protein
          Length = 479

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +3

Query: 78  SDTSFGLSLSKNGTASSGILFTLSEMSIMCQFIHWLSVFYPGA*RG 215
           + + F LSL KN  + SG+    + MS+    I W++    GA  G
Sbjct: 191 ASSQFVLSLLKNFNSISGVSLVAAVMSVSYSTIAWVASLRKGATTG 236


>At2g26140.1 68415.m03137 FtsH protease, putative contains
           similarity to YME1 GI:295582, a member of the
           ftsH-SEC18-PAS1-CDC48 family of putative ATPase-encoding
           genes from [Saccharomyces cerevisiae]
          Length = 717

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 260 GGCMRKHNRFSNRLVTSLSPRVKN*KPVNKLAHYR 156
           GG      RF +  V S + RV++ + VN++AH R
Sbjct: 43  GGASLPRTRFQSSYVGSFARRVRDREEVNEVAHLR 77


>At5g45770.1 68418.m05627 leucine-rich repeat family protein
           contains leucine rich-repeat domains Pfam:PF00560,
           INTERPRO:IPR001611
          Length = 425

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = -3

Query: 627 NQLVXQGLSHGNSMNFRHITSPSFTDASSYSKEPS 523
           NQ     ++  ++  +RHITS SFT+ SS    PS
Sbjct: 54  NQSSSSSITCDDASPYRHITSISFTNCSSTLSLPS 88


>At1g31470.1 68414.m03853 nodulin-related weak similarity to
           nodule-specific protein Nlj70 [Lotus japonicus]
           GI:3329366
          Length = 546

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 7/65 (10%)
 Frame = -2

Query: 424 IIYFNYGIFFITTIR*FEN---LKLSTFLLGYKVAVSVYKMK----NRSLTNLYLLLNSI 266
           I +FN   F I  IR F N   L LS  +    ++ ++Y +     N S +NLYLLLNS+
Sbjct: 115 ICWFNTACF-ILCIRHFPNNRALALSLTVSFNGISAALYSLAFNAINPSSSNLYLLLNSL 173

Query: 265 CLEVV 251
              VV
Sbjct: 174 VPLVV 178


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,817,140
Number of Sequences: 28952
Number of extensions: 252303
Number of successful extensions: 682
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 682
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -