SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g03850.1 68418.m00356 40S ribosomal protein S28 (RPS28B) ribo...    66   6e-12
At3g10090.1 68416.m01209 40S ribosomal protein S28 (RPS28A) simi...    66   6e-12
At5g64140.1 68418.m08054 40S ribosomal protein S28 (RPS28C)            65   1e-11
At2g43890.1 68415.m05456 polygalacturonase, putative / pectinase...    31   0.39 
At4g35500.2 68417.m05045 protein kinase family protein contains ...    29   1.6  
At4g35500.1 68417.m05044 protein kinase family protein contains ...    29   1.6  
At4g34140.1 68417.m04845 D111/G-patch domain-containing protein ...    27   3.7  
At4g02010.1 68417.m00271 protein kinase family protein contains ...    27   3.7  
At1g29590.1 68414.m03618 eukaryotic translation initiation facto...    27   4.8  
At1g29550.1 68414.m03614 eukaryotic translation initiation facto...    27   4.8  
At3g42770.1 68416.m04468 F-box family protein contains F-box dom...    26   8.5  
At1g24230.1 68414.m03055 paired amphipathic helix repeat-contain...    26   8.5  
At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati...    26   8.5  

>At5g03850.1 68418.m00356 40S ribosomal protein S28 (RPS28B)
           ribosomal protein S28, Arabidopsis thaliana,
           EMBL:ATRP28A
          Length = 64

 Score = 66.5 bits (155), Expect = 6e-12
 Identities = 34/53 (64%), Positives = 42/53 (79%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           MD     A VVKV+GRTGS+GQ TQV+V+F  ++ R I+RNVKGPVR+GDILT
Sbjct: 1   MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFT-DSDRYIMRNVKGPVREGDILT 52


>At3g10090.1 68416.m01209 40S ribosomal protein S28 (RPS28A) similar
           to ribosomal protein S28 GB:P34789 [Arabidopsis
           thaliana]
          Length = 64

 Score = 66.5 bits (155), Expect = 6e-12
 Identities = 34/53 (64%), Positives = 42/53 (79%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           MD     A VVKV+GRTGS+GQ TQV+V+F  ++ R I+RNVKGPVR+GDILT
Sbjct: 1   MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFT-DSDRYIMRNVKGPVREGDILT 52


>At5g64140.1 68418.m08054 40S ribosomal protein S28 (RPS28C)
          Length = 64

 Score = 65.3 bits (152), Expect = 1e-11
 Identities = 33/53 (62%), Positives = 42/53 (79%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           MD     A VVKV+GRTGS+GQ TQV+V+F  ++ R I+RNVKGPVR+GD+LT
Sbjct: 1   MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFT-DSDRFIMRNVKGPVREGDVLT 52


>At2g43890.1 68415.m05456 polygalacturonase, putative / pectinase,
           putative similar to SP|P48979 Polygalacturonase
           precursor (EC 3.2.1.15) (PG) (Pectinase) {Prunus
           persica}; contains Pfam profile PF00295: Glycosyl
           hydrolases family 28 (polygalacturonases)
          Length = 392

 Score = 30.7 bits (66), Expect = 0.39
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = -1

Query: 229 SEDVSVTDGSFHVSDDLTAGLPNELDLHLSTL 134
           S  V+VTDG+FH  DD  +  P   +L++S L
Sbjct: 204 SAGVTVTDGTFHTGDDCISIGPGTRNLYMSKL 235


>At4g35500.2 68417.m05045 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 439

 Score = 28.7 bits (61), Expect = 1.6
 Identities = 13/48 (27%), Positives = 26/48 (54%)
 Frame = +2

Query: 47  LSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIR 190
           LS+     +DK   + R++     +G  GQ   + +EF+G++  ++IR
Sbjct: 87  LSAAADGDLDKTKCVVRLIDHFKHSGPNGQHLCMVLEFLGDSLLRLIR 134


>At4g35500.1 68417.m05044 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 438

 Score = 28.7 bits (61), Expect = 1.6
 Identities = 13/48 (27%), Positives = 26/48 (54%)
 Frame = +2

Query: 47  LSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIR 190
           LS+     +DK   + R++     +G  GQ   + +EF+G++  ++IR
Sbjct: 86  LSAAADGDLDKTKCVVRLIDHFKHSGPNGQHLCMVLEFLGDSLLRLIR 133


>At4g34140.1 68417.m04845 D111/G-patch domain-containing protein
           contains Pfam PF01585: G-patch domain
          Length = 418

 Score = 27.5 bits (58), Expect = 3.7
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -3

Query: 152 PSLEYTGPENQYGQALSRHEQERWVYPFWLVISS 51
           P  ++   E  +G+A    E+ERW+  +  VI S
Sbjct: 134 PEEDFDPQEENFGEAAPSSEEERWLAQYGQVIES 167


>At4g02010.1 68417.m00271 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 725

 Score = 27.5 bits (58), Expect = 3.7
 Identities = 12/21 (57%), Positives = 12/21 (57%)
 Frame = +1

Query: 10  KHASFGCTCAYCIKLDITSQN 72
           K  S GC C Y IKLDI   N
Sbjct: 159 KRRSIGCHCVYPIKLDILLLN 179


>At1g29590.1 68414.m03618 eukaryotic translation initiation factor
           4E, putative / eIF-4E, putative / eIF4E, putative / mRNA
           cap-binding protein, putative similar to SP|O23252
           Eukaryotic translation initiation factor 4E (eIF-4E)
           (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa
           subunit) (eIF-4F P26 subunit) {Arabidopsis thaliana};
           contains Pfam profile PF01652: Eukaryotic initiation
           factor 4E
          Length = 285

 Score = 27.1 bits (57), Expect = 4.8
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +1

Query: 97  CRESAWPYWFSGPVYSSEGRVHWG 168
           C +++W +WF  P  S   +V WG
Sbjct: 111 CFQNSWTFWFDNP-SSKSNQVIWG 133


>At1g29550.1 68414.m03614 eukaryotic translation initiation factor
           4E, putative / eIF-4E, putative / eIF4E, putative / mRNA
           cap-binding protein, putative similar to SP|O23252
           Eukaryotic translation initiation factor 4E (eIF-4E)
           (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa
           subunit) (eIF-4F P26 subunit) {Arabidopsis thaliana};
           contains Pfam profile PF01652: Eukaryotic initiation
           factor 4E
          Length = 240

 Score = 27.1 bits (57), Expect = 4.8
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +1

Query: 97  CRESAWPYWFSGPVYSSEGRVHWG 168
           C +++W +WF  P  S   +V WG
Sbjct: 66  CFQNSWTFWFDNP-SSKSNQVIWG 88


>At3g42770.1 68416.m04468 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 532

 Score = 26.2 bits (55), Expect = 8.5
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 1/77 (1%)
 Frame = +3

Query: 81  PTFLLVS*KCLAVLVLRASVLK*RSSSLGRPAVRSSET*KDPSVTETSSLFLNLNVKLGG 260
           P FL+    C A   L    +  +  S+G P   SS+T K  SVT T   F++  +KL  
Sbjct: 174 PQFLIFLTACPA---LEDLTIYQKPHSVGMPYHISSKTIKRLSVTYTCGYFVDYGLKLFN 230

Query: 261 CDRLLQ-HYCIRLRHSH 308
              ++  +Y   +RH +
Sbjct: 231 TPSVVDLYYSDYVRHKY 247


>At1g24230.1 68414.m03055 paired amphipathic helix repeat-containing
           protein weak similarity to transcriptional co-repressor
           SIN3A [Drosophila melanogaster] GI:2570794; contains
           Pfam profile PF02671: Paired amphipathic helix repeat
          Length = 245

 Score = 26.2 bits (55), Expect = 8.5
 Identities = 11/37 (29%), Positives = 23/37 (62%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVL 112
           +FR+ PA  A+ L  L+     ++D P+ +AR+ +++
Sbjct: 97  SFRDEPAKYAQFLEILNDYSARRVDAPSAVARMTELM 133


>At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative
           / V-ATPase B subunit, putative / vacuolar proton pump B
           subunit, putative / V-ATPase 57 kDa subunit, putative
           strong similarity to SP|P11574 Vacuolar ATP synthase
           subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar
           proton pump B subunit) (V-ATPase 57 kDa subunit)
           {Arabidopsis thaliana}; contains Pfam profiles PF00006:
           ATP synthase alpha/beta family nucleotide-binding
           domain, PF02874: ATP synthase alpha/beta family
           beta-barrel domain
          Length = 485

 Score = 26.2 bits (55), Expect = 8.5
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +1

Query: 85  RSCSCRESAWPYWFSGPVYSSEGRVH 162
           R C  R S+W  W SG  Y+    ++
Sbjct: 285 RFCCSRRSSWKTWISGVYYTDLATIY 310


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,470,680
Number of Sequences: 28952
Number of extensions: 151979
Number of successful extensions: 383
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 380
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 605614832
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -