SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A12
         (413 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B) ribo...    52   1e-07
At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C) ribo...    51   4e-07
At3g18190.1 68416.m02314 chaperonin, putative similar to SWISS-P...    27   6.6  
At3g04890.1 68416.m00531 expressed protein                             27   6.6  

>At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B)
           ribosomal protein S21, cytosolic - Oryza sativa,
           PIR:S38357
          Length = 82

 Score = 52.4 bits (120), Expect = 1e-07
 Identities = 21/31 (67%), Positives = 27/31 (87%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           M+NDAG+  +LY PRKCSA+NR+I +KDHAS
Sbjct: 1   MENDAGQVTELYIPRKCSATNRMITSKDHAS 31


>At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C)
           ribosomal protein S21, Zea mays, PIR:T03945
          Length = 85

 Score = 50.8 bits (116), Expect = 4e-07
 Identities = 21/31 (67%), Positives = 26/31 (83%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQN+ G+  +LY PRKCSA+NRLI +KDHAS
Sbjct: 1   MQNEEGQVTELYIPRKCSATNRLITSKDHAS 31


>At3g18190.1 68416.m02314 chaperonin, putative similar to
           SWISS-PROT:P50991- T-complex protein 1, delta subunit
           (TCP-1-delta) [Homo sapiens]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 536

 Score = 26.6 bits (56), Expect = 6.6
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = -3

Query: 219 QTTYILDVSAARPVAGSTSAI---TSCX*SMVLSVDEAVAGR 103
           Q T IL+ +  +P+  STSAI   T C   M+L +D+ V  R
Sbjct: 496 QITNILEENVVQPLLVSTSAITLATECV-RMILKIDDIVTVR 536


>At3g04890.1 68416.m00531 expressed protein
          Length = 216

 Score = 26.6 bits (56), Expect = 6.6
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%)
 Frame = +2

Query: 101 ARPATASSTLRTMLQXQLVIADVDPATG-RAADTSKMYVVCGAIRRMGESDDCI 259
           A  +T+ +T +   + ++   DVD   G   +D    Y V G +     SDDCI
Sbjct: 55  APSSTSIATNKDRSKNEVTAGDVDDVMGILRSDYRNFYFVTGVLTSAIYSDDCI 108


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,525,491
Number of Sequences: 28952
Number of extensions: 133572
Number of successful extensions: 280
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 278
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 280
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 625471056
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -