SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB)      71   5e-13
At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA...    71   5e-13
At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) near...    29   2.0  
At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containi...    27   4.5  
At5g45460.1 68418.m05585 expressed protein                             27   6.0  
At5g25590.1 68418.m03045 expressed protein contains Pfam profile...    27   7.9  

>At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB)
          Length = 105

 Score = 70.5 bits (165), Expect = 5e-13
 Identities = 31/52 (59%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVLRL+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 50  YGGQTKPVFHKKAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101



 Score = 29.5 bits (63), Expect = 1.1
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)
 Frame = +3

Query: 111 MVNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVN+PK + TY              +QYKK K+  AAQG
Sbjct: 1   MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQG 39



 Score = 27.9 bits (59), Expect = 3.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 13  KNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAK 63


>At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA)
           similar to ribosomal protein L41 GB:AAA34366 from
           [Candida maltosa]
          Length = 105

 Score = 70.5 bits (165), Expect = 5e-13
 Identities = 31/52 (59%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVLRL+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 50  YGGQTKPVFHKKAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101



 Score = 29.5 bits (63), Expect = 1.1
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)
 Frame = +3

Query: 111 MVNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVN+PK + TY              +QYKK K+  AAQG
Sbjct: 1   MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQG 39



 Score = 27.9 bits (59), Expect = 3.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 13  KNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAK 63


>At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) nearly
           identical to RelA/SpoT homolog RSH2 [Arabidopsis
           thaliana] GI:7141306; contains Pfam profiles PF01966: HD
           domain, PF04607: Region found in RelA / SpoT proteins
          Length = 709

 Score = 28.7 bits (61), Expect = 2.0
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = -2

Query: 402 LFLSPPSSKCLHLFNATCDLTLQSAHSRRST 310
           L+ SPPSS C      +CDL L S  S  S+
Sbjct: 9   LYASPPSSVCSTPHQISCDLDLTSRSSSTSS 39


>At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containing
           protein contains Pfam profile PF00515 TPR Domain
          Length = 798

 Score = 27.5 bits (58), Expect = 4.5
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -2

Query: 180 IPCVLCGIYIFCSTSCAV 127
           +PC  C I ++CS SC +
Sbjct: 275 VPCPSCSIPVYCSESCQI 292


>At5g45460.1 68418.m05585 expressed protein
          Length = 703

 Score = 27.1 bits (57), Expect = 6.0
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 4/43 (9%)
 Frame = -1

Query: 181 DTLCTLWHLHFLQ----YVLRCFGTFTIFEFVRHDINKRQKEI 65
           D  C++ H+H +     +  R  G+  +F F+ +   KRQK I
Sbjct: 427 DDKCSMVHVHHMLTTPFFFRRWCGSINVFNFLAYATKKRQKRI 469


>At5g25590.1 68418.m03045 expressed protein contains Pfam profile
           PF04783: Protein of unknown function (DUF630)
          Length = 775

 Score = 26.6 bits (56), Expect = 7.9
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = +1

Query: 223 RRRYDRKQQGLRWSVQTHLQKEG 291
           RR + RK+QG     Q HLQK G
Sbjct: 656 RREFIRKKQGFEDWYQKHLQKRG 678


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,430,038
Number of Sequences: 28952
Number of extensions: 177719
Number of successful extensions: 488
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 476
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 486
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 752336160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -