SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g04920.1 68416.m00534 40S ribosomal protein S24 (RPS24A) simi...   170   6e-43
At5g28060.1 68418.m03382 40S ribosomal protein S24 (RPS24B) 40S ...   166   1e-41
At5g07570.1 68418.m00867 glycine/proline-rich protein contains s...    29   2.0  
At5g23040.2 68418.m02694 expressed protein similar to unknown pr...    28   4.7  
At5g23040.1 68418.m02693 expressed protein similar to unknown pr...    28   4.7  
At5g26850.1 68418.m03203 expressed protein                             28   6.2  
At5g52700.1 68418.m06542 heavy-metal-associated domain-containin...    27   8.2  

>At3g04920.1 68416.m00534 40S ribosomal protein S24 (RPS24A) similar
           to ribosomal protein S19 GB:445612 [Solanum tuberosum]
           and similar to ribosomal protein S24 GB:4506703 [Homo
           sapiens]
          Length = 133

 Score =  170 bits (414), Expect = 6e-43
 Identities = 81/121 (66%), Positives = 99/121 (81%), Gaps = 1/121 (0%)
 Frame = +1

Query: 88  MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVT-PDVVFVF 264
           M+E   TIRTRKFMTNRLL+RKQ V DVLHPG+  VSK E++EKLA+MY+V  P+ +FVF
Sbjct: 1   MAEKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFVF 60

Query: 265 GFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVR 444
            F+T+FGGGKS+GF LIYDT++ AKKFEPK+RL R+GL  K   +RKQ KERKNR KK+R
Sbjct: 61  KFRTHFGGGKSSGFGLIYDTVESAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120

Query: 445 G 447
           G
Sbjct: 121 G 121


>At5g28060.1 68418.m03382 40S ribosomal protein S24 (RPS24B) 40S
           ribosomal protein S19, Cyanophora paradoxa,
           EMBL:CPA245654
          Length = 133

 Score =  166 bits (403), Expect = 1e-41
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 1/121 (0%)
 Frame = +1

Query: 88  MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVT-PDVVFVF 264
           M+E   TIRTR FMTNRLLARKQ V DVLHPG+  VSK E++EKLA+MY+V  P+ +F F
Sbjct: 1   MAEKAVTIRTRNFMTNRLLARKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFCF 60

Query: 265 GFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVR 444
            F+T+FGGGKS+G+ LIYDT++ AKKFEPK+RL R+GL  K   +RKQ KERKNR KK+R
Sbjct: 61  KFRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120

Query: 445 G 447
           G
Sbjct: 121 G 121


>At5g07570.1 68418.m00867 glycine/proline-rich protein contains
           similarity to flagelliform silk protein [Nephila
           clavipes] gi|7106224|gb|AAF36090
          Length = 1504

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +1

Query: 247 DVVFVFGFKTNFGGGKSTGFALIYDT 324
           DV FV GF T+F  G   GFA+ + T
Sbjct: 251 DVGFVVGFVTSFAAGLDVGFAIDFAT 276



 Score = 27.9 bits (59), Expect = 6.2
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 256 FVFGFKTNFGGGKSTGFALIYDT 324
           FV GF T+F  G  TGF + +DT
Sbjct: 110 FVTGFATDFDVGFDTGFTIGFDT 132


>At5g23040.2 68418.m02694 expressed protein similar to unknown
           protein (emb|CAB62636.1)
          Length = 258

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = -3

Query: 144 QQSVGHELASANSRCSFTHFELFSIIRRLHARVSAKTREKERV 16
           QQ  GHE +  +   +F    + S IRR   +++ K++ K++V
Sbjct: 93  QQYAGHERSEESIEGAFEKLLMSSFIRRKKTKINLKSKLKKKV 135


>At5g23040.1 68418.m02693 expressed protein similar to unknown
           protein (emb|CAB62636.1)
          Length = 258

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = -3

Query: 144 QQSVGHELASANSRCSFTHFELFSIIRRLHARVSAKTREKERV 16
           QQ  GHE +  +   +F    + S IRR   +++ K++ K++V
Sbjct: 93  QQYAGHERSEESIEGAFEKLLMSSFIRRKKTKINLKSKLKKKV 135


>At5g26850.1 68418.m03203 expressed protein
          Length = 919

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +1

Query: 127 MTNRLLARKQMVCDVLHPGKPTVSKTEIRE-KLAKMYKVTPDVVFVFGFKTN 279
           M +++     ++ D++    P +SK E  + K+  + + TPD  F+FG + N
Sbjct: 702 MRSKVELSNTIITDIVAKNLPKLSKLEEADVKMQILEQFTPDDAFMFGSRPN 753


>At5g52700.1 68418.m06542 heavy-metal-associated domain-containing
           protein   contains Pfam profile PF00403:
           Heavy-metal-associated domain
          Length = 370

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = +3

Query: 297 NWIRFDLRHTRSGQEVRAQAQVSPPRPVR-EEEAHAQTA*RT*EQNEEGPRYQE 455
           N   F++++  S   V A+ +V PP PVR     +A    +   Q  E P Y++
Sbjct: 202 NGTNFNMKNALSSFRVPARVRVPPPPPVRPASPVYAAGRGKKFNQGNEFPTYKQ 255


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,838,169
Number of Sequences: 28952
Number of extensions: 287393
Number of successful extensions: 794
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 760
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 789
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -