SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep...   146   8e-36
At3g18130.1 68416.m02305 guanine nucleotide-binding family prote...   144   3e-35
At1g48630.1 68414.m05440 guanine nucleotide-binding family prote...   142   2e-34
At3g49660.1 68416.m05427 transducin family protein / WD-40 repea...    60   2e-09
At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless...    55   2e-09
At2g43770.1 68415.m05441 transducin family protein / WD-40 repea...    59   2e-09
At3g18140.1 68416.m02306 transducin family protein / WD-40 repea...    58   5e-09
At4g02730.1 68417.m00372 transducin family protein / WD-40 repea...    57   1e-08
At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta...    55   3e-08
At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta...    55   3e-08
At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta...    55   3e-08
At2g22040.1 68415.m02617 transducin family protein / WD-40 repea...    54   8e-08
At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p...    53   2e-07
At1g10580.1 68414.m01192 transducin family protein / WD-40 repea...    52   3e-07
At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regul...    52   4e-07
At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regul...    52   4e-07
At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ...    52   4e-07
At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p...    52   4e-07
At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ...    51   7e-07
At5g25150.1 68418.m02981 transducin family protein / WD-40 repea...    50   1e-06
At3g05090.2 68416.m00553 transducin family protein / WD-40 repea...    50   1e-06
At3g05090.1 68416.m00552 transducin family protein / WD-40 repea...    50   1e-06
At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ...    50   2e-06
At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ...    50   2e-06
At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ...    50   2e-06
At3g21540.1 68416.m02717 transducin family protein / WD-40 repea...    49   2e-06
At5g08390.1 68418.m00988 transducin family protein / WD-40 repea...    48   7e-06
At1g73720.1 68414.m08536 transducin family protein / WD-40 repea...    48   7e-06
At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf...    47   9e-06
At5g23430.2 68418.m02749 transducin family protein / WD-40 repea...    47   9e-06
At5g23430.1 68418.m02748 transducin family protein / WD-40 repea...    47   9e-06
At4g28450.1 68417.m04071 transducin family protein / WD-40 repea...    46   2e-05
At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf...    46   3e-05
At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf...    46   3e-05
At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha...    46   3e-05
At5g16750.1 68418.m01961 transducin family protein / WD-40 repea...    45   4e-05
At5g15550.2 68418.m01821 transducin family protein / WD-40 repea...    45   4e-05
At5g15550.1 68418.m01820 transducin family protein / WD-40 repea...    45   4e-05
At1g04510.1 68414.m00442 transducin family protein / WD-40 repea...    45   5e-05
At5g08560.1 68418.m01018 transducin family protein / WD-40 repea...    44   6e-05
At2g33340.2 68415.m04087 transducin family protein / WD-40 repea...    44   6e-05
At2g33340.1 68415.m04086 transducin family protein / WD-40 repea...    44   6e-05
At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ...    44   8e-05
At3g18860.2 68416.m02396 transducin family protein / WD-40 repea...    44   8e-05
At3g18860.1 68416.m02395 transducin family protein / WD-40 repea...    44   8e-05
At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc...    44   8e-05
At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro...    43   2e-04
At4g32990.1 68417.m04692 transducin family protein / WD-40 repea...    43   2e-04
At2g16405.1 68415.m01878 transducin family protein / WD-40 repea...    43   2e-04
At5g64730.1 68418.m08140 transducin family protein / WD-40 repea...    42   3e-04
At4g29830.1 68417.m04246 transducin family protein / WD-40 repea...    42   3e-04
At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf...    42   4e-04
At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ...    42   4e-04
At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p...    42   4e-04
At5g64630.2 68418.m08122 transducin family protein / WD-40 repea...    41   6e-04
At5g64630.1 68418.m08121 transducin family protein / WD-40 repea...    41   6e-04
At5g50230.1 68418.m06221 transducin family protein / WD-40 repea...    41   6e-04
At2g46290.1 68415.m05758 eukaryotic translation initiation facto...    41   8e-04
At5g50120.1 68418.m06207 transducin family protein / WD-40 repea...    40   0.001
At3g44530.1 68416.m04786 transducin family protein / WD-40 repea...    40   0.001
At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha...    40   0.001
At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro...    40   0.002
At2g20330.1 68415.m02374 transducin family protein / WD-40 repea...    40   0.002
At5g64630.3 68418.m08123 transducin family protein / WD-40 repea...    39   0.002
At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 ...    39   0.002
At1g71840.1 68414.m08302 transducin family protein / WD-40 repea...    39   0.002
At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 pro...    39   0.003
At4g04940.1 68417.m00718 transducin family protein / WD-40 repea...    39   0.003
At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi...    38   0.004
At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf...    38   0.004
At1g15850.1 68414.m01902 transducin family protein / WD-40 repea...    38   0.004
At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pf...    38   0.005
At4g35050.1 68417.m04974 WD-40 repeat protein (MSI3) contains 5 ...    38   0.005
At4g18900.1 68417.m02786 transducin family protein / WD-40 repea...    38   0.005
At2g46280.3 68415.m05757 eukaryotic translation initiation facto...    38   0.005
At2g46280.2 68415.m05756 eukaryotic translation initiation facto...    38   0.005
At2g46280.1 68415.m05755 eukaryotic translation initiation facto...    38   0.005
At5g49430.1 68418.m06116 transducin family protein / WD-40 repea...    38   0.007
At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ...    38   0.007
At1g49450.1 68414.m05543 transducin family protein / WD-40 repea...    38   0.007
At1g24530.1 68414.m03088 transducin family protein / WD-40 repea...    38   0.007
At1g24130.1 68414.m03044 transducin family protein / WD-40 repea...    38   0.007
At5g56130.1 68418.m07002 transducin family protein / WD-40 repea...    37   0.010
At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 ...    37   0.010
At4g03020.1 68417.m00410 transducin family protein / WD-40 repea...    37   0.010
At2g26060.1 68415.m03129 transducin family protein / WD-40 repea...    37   0.010
At2g19430.1 68415.m02267 transducin family protein / WD-40 repea...    37   0.010
At3g49180.1 68416.m05375 transducin family protein / WD-40 repea...    37   0.013
At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf...    37   0.013
At3g50390.1 68416.m05512 transducin family protein / WD-40 repea...    35   0.016
At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 pro...    36   0.017
At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene...    36   0.017
At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 ...    36   0.017
At1g80670.1 68414.m09466 transducin family protein / WD-40 repea...    36   0.017
At1g15440.2 68414.m01856 transducin family protein / WD-40 repea...    36   0.017
At1g15440.1 68414.m01855 transducin family protein / WD-40 repea...    36   0.017
At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co...    36   0.022
At3g27640.1 68416.m03452 transducin family protein / WD-40 repea...    36   0.022
At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ...    36   0.022
At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ...    36   0.022
At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ...    36   0.022
At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ...    36   0.022
At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ...    36   0.022
At5g58230.1 68418.m07290 WD-40 repeat protein (MSI1) contains 6 ...    36   0.029
At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 ...    36   0.029
At3g20740.1 68416.m02624 fertilization-independent endosperm pro...    36   0.029
At2g47990.1 68415.m06006 transducin family protein / WD-40 repea...    35   0.038
At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 rec...    35   0.038
At1g03110.1 68414.m00288 transducin family protein / WD-40 repea...    35   0.038
At3g18950.1 68416.m02405 transducin family protein / WD-40 repea...    35   0.051
At3g06880.1 68416.m00817 transducin family protein / WD-40 repea...    35   0.051
At2g47410.1 68415.m05917 transducin family protein / WD-40 repea...    35   0.051
At1g27840.1 68414.m03412 transducin family protein / WD-40 repea...    35   0.051
At5g43920.1 68418.m05372 transducin family protein / WD-40 repea...    34   0.067
At5g21040.1 68418.m02503 F-box family protein / WD-40 repeat fam...    34   0.067
At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 ...    34   0.067
At3g13300.2 68416.m01675 transducin family protein / WD-40 repea...    34   0.067
At3g13300.1 68416.m01674 transducin family protein / WD-40 repea...    34   0.067
At3g01340.1 68416.m00051 protein transport protein SEC13 family ...    34   0.067
At2g30050.1 68415.m03654 transducin family protein / WD-40 repea...    34   0.089
At1g21650.1 68414.m02710 preprotein translocase secA family prot...    34   0.089
At4g21130.1 68417.m03055 transducin family protein / WD-40 repea...    33   0.12 
At4g35370.1 68417.m05025 transducin family protein / WD-40 repea...    33   0.16 
At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel...    33   0.16 
At1g76260.1 68414.m08855 transducin family protein / WD-40 repea...    33   0.16 
At1g20540.1 68414.m02559 transducin family protein / WD-40 repea...    33   0.16 
At4g29380.1 68417.m04197 protein kinase family protein / WD-40 r...    33   0.21 
At4g05410.1 68417.m00823 transducin family protein / WD-40 repea...    33   0.21 
At2g40360.1 68415.m04977 transducin family protein / WD-40 repea...    33   0.21 
At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf...    32   0.27 
At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf...    32   0.27 
At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pf...    32   0.27 
At5g14530.1 68418.m01703 transducin family protein / WD-40 repea...    32   0.27 
At4g34380.1 68417.m04884 transducin family protein / WD-40 repea...    32   0.27 
At1g18830.1 68414.m02345 transducin family protein / WD-40 repea...    32   0.27 
At5g23730.1 68418.m02782 transducin family protein / WD-40 repea...    32   0.36 
At4g38480.1 68417.m05438 transducin family protein / WD-40 repea...    32   0.36 
At4g22910.1 68417.m03309 WD-40 repeat family protein contains 6 ...    32   0.36 
At2g26490.1 68415.m03178 transducin family protein / WD-40 repea...    31   0.47 
At1g19750.1 68414.m02469 transducin family protein / WD-40 repea...    31   0.47 
At5g58760.1 68418.m07360 transducin family protein / WD-40 repea...    31   0.63 
At5g27945.1 68418.m03364 transducin family protein / WD-40 repea...    31   0.63 
At4g35140.1 68417.m04996 transducin family protein / WD-40 repea...    31   0.63 
At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro...    31   0.63 
At3g51930.1 68416.m05696 transducin family protein / WD-40 repea...    31   0.63 
At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c...    31   0.63 
At1g17720.2 68414.m02194 serine/threonine protein phosphatase 2A...    31   0.63 
At1g17720.1 68414.m02193 serine/threonine protein phosphatase 2A...    31   0.63 
At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 ...    31   0.83 
At4g29860.1 68417.m04250 transducin family protein / WD-40 repea...    31   0.83 
At4g01860.2 68417.m00244 transducin family protein / WD-40 repea...    31   0.83 
At4g01860.1 68417.m00243 transducin family protein / WD-40 repea...    31   0.83 
At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica...    31   0.83 
At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica...    31   0.83 
At3g45620.1 68416.m04927 transducin family protein / WD-40 repea...    31   0.83 
At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-rel...    31   0.83 
At1g47610.1 68414.m05288 transducin family protein / WD-40 repea...    31   0.83 
At5g66240.2 68418.m08345 transducin family protein / WD-40 repea...    30   1.1  
At5g66240.1 68418.m08344 transducin family protein / WD-40 repea...    30   1.1  
At4g18905.1 68417.m02787 transducin family protein / WD-40 repea...    30   1.1  
At3g13290.1 68416.m01673 transducin family protein / WD-40 repea...    30   1.1  
At1g49540.1 68414.m05553 transducin family protein / WD-40 repea...    30   1.1  
At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c...    30   1.4  
At3g15354.1 68416.m01939 WD-40 repeat family protein / phytochro...    30   1.4  
At2g35860.1 68415.m04403 beta-Ig-H3 domain-containing protein / ...    30   1.4  
At2g01330.1 68415.m00050 transducin family protein / WD-40 repea...    30   1.4  
At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 ...    29   1.9  
At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ...    29   1.9  
At4g02660.1 68417.m00361 WD-40 repeat family protein / beige-rel...    29   1.9  
At3g21060.1 68416.m02662 transducin family protein / WD-40 repea...    29   1.9  
At2g05720.1 68415.m00613 transducin family protein / WD-40 repea...    29   1.9  
At1g15470.1 68414.m01860 transducin family protein / WD-40 repea...    29   1.9  
At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-rel...    29   1.9  
At5g45760.2 68418.m05626 transducin family protein / WD-40 repea...    29   2.5  
At5g45760.1 68418.m05625 transducin family protein / WD-40 repea...    29   2.5  
At5g10940.1 68418.m01269 transducin family protein / WD-40 repea...    29   2.5  
At4g21520.1 68417.m03110 transducin family protein / WD-40 repea...    29   2.5  
At3g18060.1 68416.m02297 transducin family protein / WD-40 repea...    29   2.5  
At2g18900.1 68415.m02205 transducin family protein / WD-40 repea...    29   2.5  
At4g11270.1 68417.m01823 transducin family protein / WD-40 repea...    29   3.3  
At2g43945.1 68415.m05462 expressed protein                             29   3.3  
At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochro...    29   3.3  
At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochro...    29   3.3  
At5g60050.1 68418.m07530 PRLI-interacting factor-related contain...    28   4.4  
At3g13340.1 68416.m01679 WD-40 repeat family protein contains Pf...    28   4.4  
At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10...    28   4.4  
At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10...    28   4.4  
At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 ...    28   5.8  
At3g15610.1 68416.m01980 transducin family protein / WD-40 repea...    28   5.8  
At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ...    28   5.8  
At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ...    28   5.8  
At4g03970.1 68417.m00561 Ulp1 protease family protein contains P...    27   7.7  
At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pf...    27   7.7  
At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pf...    27   7.7  
At2g46340.1 68415.m05768 phytochrome A supressor spa1 (SPA1) ide...    27   7.7  
At1g55680.1 68414.m06374 WD-40 repeat family protein contains 2 ...    27   7.7  
At1g52730.2 68414.m05959 transducin family protein / WD-40 repea...    27   7.7  
At1g52730.1 68414.m05958 transducin family protein / WD-40 repea...    27   7.7  

>At1g18080.1 68414.m02238 WD-40 repeat family protein /
           auxin-dependent protein (ARCA) / guanine
           nucleotide-binding protein beta subunit, putative
           identical to SP|O24456 Guanine nucleotide-binding
           protein beta subunit-like protein (WD-40 repeat
           auxin-dependent protein ARCA) {Arabidopsis thaliana};
           contains 7 WD-40 repeats (PF00400)
          Length = 327

 Score =  146 bits (355), Expect = 8e-36
 Identities = 67/106 (63%), Positives = 83/106 (78%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E L L+GT+R H   VT IAT     D+I+S+SRDK++I+WKLT+D+  YG+ Q+RL 
Sbjct: 1   MAEGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLT 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+ DVVLSSDG +ALSGSWD  LRLWDLAAG +TRRF  HTK
Sbjct: 61  GHSHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTK 106



 Score = 57.6 bits (133), Expect = 6e-09
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPK-YPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           GH  WV+ +  +P      I+S+S DKT+ VW L+  +      +  L GH+ ++S V +
Sbjct: 148 GHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL-----RSTLAGHTGYVSTVAV 202

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           S DG+   SG  D  + LWDLA GK     E ++ +
Sbjct: 203 SPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVI 238



 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 22/87 (25%), Positives = 42/87 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KLR TL GH G+V+ +A +P    +  S  +D  +++W L   +  Y +        ++ 
Sbjct: 185 KLRSTLAGHTGYVSTVAVSPD-GSLCASGGKDGVVLLWDLAEGKKLYSL-------EANS 236

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +   +  S   Y L  + +  +++WDL
Sbjct: 237 VIHALCFSPNRYWLCAATEHGIKIWDL 263



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 24/81 (29%), Positives = 38/81 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +V  +  +       LS S D  L +W L       G+  +R  GH+  +  V 
Sbjct: 59  LTGHSHFVEDVVLSSD-GQFALSGSWDGELRLWDLAA-----GVSTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S D    +S S D+T++LW+
Sbjct: 113 FSLDNRQIVSASRDRTIKLWN 133


>At3g18130.1 68416.m02305 guanine nucleotide-binding family protein
           / activated protein kinase C receptor (RACK1) identical
           to guanine nucleotide-binding protein; activated protein
           kinase C receptor; RACK1 (GI:9294068) {Arabidopsis
           thaliana}; contains Pfam profile: PF00400 WD domain,
           G-beta repeat (7 copies)
          Length = 326

 Score =  144 bits (350), Expect = 3e-35
 Identities = 65/106 (61%), Positives = 83/106 (78%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E L L+G +R H   VT IAT     D+I+++SRDK++I+WKLT+D+ +YG+ Q+RL 
Sbjct: 1   MAEGLVLKGIMRAHTDIVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLT 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+ DVVLSSDG +ALSGSWD  LRLWDLA G+TTRRF  HTK
Sbjct: 61  GHSHFVEDVVLSSDGQFALSGSWDGELRLWDLATGETTRRFVGHTK 106



 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPK-YPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           GH  WV+ +  +P      I+S+S DKT+ VW L     N  + +  L GHS +++ V +
Sbjct: 147 GHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNL----QNCKL-RNSLVGHSGYLNTVAV 201

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGK 328
           S DG+   SG  D  + LWDLA GK
Sbjct: 202 SPDGSLCASGGKDGVILLWDLAEGK 226



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 23/90 (25%), Positives = 44/90 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +  KLR +L GH+G++  +A +P    +  S  +D  +++W L   +  Y +    +  H
Sbjct: 181 QNCKLRNSLVGHSGYLNTVAVSPD-GSLCASGGKDGVILLWDLAEGKKLYSLEAGSII-H 238

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S      +  S   Y L  + + ++R+WDL
Sbjct: 239 S------LCFSPNRYWLCAATENSIRIWDL 262



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYA--LSGSWDKTLR 304
           I+S+SRD+T+ +W  T  E  Y I +    GH  ++S V  S +      +S SWDKT++
Sbjct: 120 IVSASRDRTIKLWN-TLGECKYTISEGD--GHKEWVSCVRFSPNTLVPTIVSASWDKTVK 176

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+L   K       H+
Sbjct: 177 VWNLQNCKLRNSLVGHS 193



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 24/81 (29%), Positives = 38/81 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +V  +  +       LS S D  L +W L   E       +R  GH+  +  V 
Sbjct: 59  LTGHSHFVEDVVLSSD-GQFALSGSWDGELRLWDLATGETT-----RRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S+D    +S S D+T++LW+
Sbjct: 113 FSTDNRQIVSASRDRTIKLWN 133


>At1g48630.1 68414.m05440 guanine nucleotide-binding family protein
           / activated protein kinase C receptor, putative / RACK,
           putative contains 7 WD-40 repeats (PF00400); very
           similar to guanine nucleotide-binding protein; activated
           protein kinase C receptor; RACK1 (GI:9294068)
           {Arabidopsis thaliana}; similar to WD-40 repeat
           auxin-dependent protein ARCA (SP:O24456) [Arabidopsis
           thaliana];
          Length = 326

 Score =  142 bits (344), Expect = 2e-34
 Identities = 63/106 (59%), Positives = 83/106 (78%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E L L+GT+  H   VT IAT     D+I++SSRDK++I+WKLT+++ +YG+ Q+R+ 
Sbjct: 1   MAEGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMT 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+ DVVLSSDG +ALSGSWD  LRLWDLA G++TRRF  HTK
Sbjct: 61  GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTK 106



 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPK-YPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           GH  WV+ +  +P      I+S+S DKT+ VW L     N  + +  L GHS +++ V +
Sbjct: 147 GHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNL----QNCKL-RNTLAGHSGYLNTVAV 201

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGK 328
           S DG+   SG  D  + LWDLA GK
Sbjct: 202 SPDGSLCASGGKDGVILLWDLAEGK 226



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 24/90 (26%), Positives = 44/90 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +  KLR TL GH+G++  +A +P    +  S  +D  +++W L   +  Y +    +  H
Sbjct: 181 QNCKLRNTLAGHSGYLNTVAVSPD-GSLCASGGKDGVILLWDLAEGKKLYSLEAGSII-H 238

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S      +  S   Y L  + + ++R+WDL
Sbjct: 239 S------LCFSPNRYWLCAATENSIRIWDL 262



 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYA--LSGSWDKTLR 304
           I+S+SRD+T+ +W  T  E  Y I +    GH  ++S V  S +      +S SWDKT++
Sbjct: 120 IVSASRDRTIKLWN-TLGECKYTISEAD--GHKEWVSCVRFSPNTLVPTIVSASWDKTVK 176

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+L   K       H+
Sbjct: 177 VWNLQNCKLRNTLAGHS 193



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH+ +V  +  +       LS S D  L +W L   E+      +R  GH+  +  V 
Sbjct: 59  MTGHSHFVQDVVLSSD-GQFALSGSWDGELRLWDLATGEST-----RRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S+D    +S S D+T++LW+
Sbjct: 113 FSTDNRQIVSASRDRTIKLWN 133


>At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat
           family protein beta-transducin, Schizosaccharomyces
           pombe, EMBL:CAA17803
          Length = 317

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 32/96 (33%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  HN  V+ +  +     ++ S+S DKT+  + +    +    P +   GH + ISDV
Sbjct: 19  TLTSHNRAVSSVKFSSD-GRLLASASADKTIRTYTINTINDPIAEPVQEFTGHENGISDV 77

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             SSD  + +S S DKTL+LWD+  G   +    HT
Sbjct: 78  AFSSDARFIVSASDDKTLKLWDVETGSLIKTLIGHT 113



 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 29/93 (31%), Positives = 49/93 (52%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   ++ +A +      I+S+S DKTL +W +       G   K L GH+++   V  +
Sbjct: 69  GHENGISDVAFSSD-ARFIVSASDDKTLKLWDVET-----GSLIKTLIGHTNYAFCVNFN 122

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              N  +SGS+D+T+R+WD+  GK  +    H+
Sbjct: 123 PQSNMIVSGSFDETVRIWDVTTGKCLKVLPAHS 155



 Score = 37.9 bits (84), Expect = 0.005
 Identities = 28/101 (27%), Positives = 47/101 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K    L  H+  VT +  N +   +I+SSS D    +W    D       +  +   +
Sbjct: 144 TGKCLKVLPAHSDPVTAVDFN-RDGSLIVSSSYDGLCRIW----DSGTGHCVKTLIDDEN 198

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +S V  S +G + L G+ D TLRLW++++ K  + +  H
Sbjct: 199 PPVSFVRFSPNGKFILVGTLDNTLRLWNISSAKFLKTYTGH 239



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 22/60 (36%), Positives = 33/60 (55%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I+S S D  + +W+L    N+  + QK L GH+  + +V      N   SGS DKT+R+W
Sbjct: 258 IVSGSEDNCVHMWEL----NSKKLLQK-LEGHTETVMNVACHPTENLIASGSLDKTVRIW 312



 Score = 33.9 bits (74), Expect = 0.089
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 3/83 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH---SHFISDVVLSSDGNYALSGSWDKTL 301
           IL  + D TL +W ++  +       K   GH    + IS     ++G   +SGS D  +
Sbjct: 213 ILVGTLDNTLRLWNISSAKF-----LKTYTGHVNAQYCISSAFSVTNGKRIVSGSEDNCV 267

Query: 302 RLWDLAAGKTTRRFEDHTKV*QN 370
            +W+L + K  ++ E HT+   N
Sbjct: 268 HMWELNSKKLLQKLEGHTETVMN 290



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +  + L  H+  +S V  SSDG    S S DKT+R + +
Sbjct: 15  VHSQTLTSHNRAVSSVKFSSDGRLLASASADKTIRTYTI 53


>At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless
           protein, putative similar to notchless [Xenopus laevis]
           GI:3687833; contains Pfam PF00400: WD domain, G-beta
           repeat (8 copies)
          Length = 473

 Score = 54.8 bits (126), Expect(2) = 2e-09
 Identities = 26/77 (33%), Positives = 43/77 (55%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P+ ++S S D T+ +W+ +  +     P+KRL GH   ++ V  S DG +  S S+DK++
Sbjct: 329 PERLVSGSDDFTMFLWEPSVSKQ----PKKRLTGHQQLVNHVYFSPDGKWIASASFDKSV 384

Query: 302 RLWDLAAGKTTRRFEDH 352
           RLW+   G+    F  H
Sbjct: 385 RLWNGITGQFVTVFRGH 401



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 26/79 (32%), Positives = 42/79 (53%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH G V Q++ +     ++LS S+D TL +W++   +    +P     GH+  +  V  
Sbjct: 399 RGHVGPVYQVSWSAD-SRLLLSGSKDSTLKIWEIRTKKLKQDLP-----GHADEVFAVDW 452

Query: 254 SSDGNYALSGSWDKTLRLW 310
           S DG   +SG  D+ L+LW
Sbjct: 453 SPDGEKVVSGGKDRVLKLW 471



 Score = 36.7 bits (81), Expect = 0.013
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 5/101 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH  WV  +A +P    ++ S S+   +  W   + E   G P   L GH  +I+ +
Sbjct: 146 TCKGHKNWVLTVAWSPDGKHLV-SGSKSGEICCWNPKKGELE-GSP---LTGHKKWITGI 200

Query: 248 V-----LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                 LSS     ++ S D   R+WD+   K+      HT
Sbjct: 201 SWEPVHLSSPCRRFVTSSKDGDARIWDITLKKSIICLSGHT 241



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  V  S DG    SGS D T+RLWDL
Sbjct: 107 GHAEAVLCVSFSPDGKQLASGSGDTTVRLWDL 138



 Score = 34.7 bits (76), Expect = 0.051
 Identities = 27/94 (28%), Positives = 40/94 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +  +P     I S+S DK++ +W         G       GH   +  V 
Sbjct: 356 LTGHQQLVNHVYFSPD-GKWIASASFDKSVRLWN-----GITGQFVTVFRGHVGPVYQVS 409

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    LSGS D TL++W++   K  +    H
Sbjct: 410 WSADSRLLLSGSKDSTLKIWEIRTKKLKQDLPGH 443



 Score = 32.3 bits (70), Expect = 0.27
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH   V  ++ +P     + S S D T+ +W L  +      P     GH +++  V
Sbjct: 104 TIAGHAEAVLCVSFSPD-GKQLASGSGDTTVRLWDLYTET-----PLFTCKGHKNWVLTV 157

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
             S DG + +SGS    +  W+   G+
Sbjct: 158 AWSPDGKHLVSGSKSGEICCWNPKKGE 184



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL-SGSWDKTLR 304
           +I + S+D T+ +W+ T+     G   + L GH H+I+ + LS++  Y L +G++D T R
Sbjct: 254 IIYTGSQDCTIKMWETTQ-----GKLIRELKGHGHWINSLALSTE--YVLRTGAFDHTGR 306



 Score = 24.6 bits (51), Expect(2) = 2e-09
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%)
 Frame = +2

Query: 38  KMSETL--KLRGTLRGHNGWVTQIATNPKY 121
           KM ET   KL   L+GH  W+  +A + +Y
Sbjct: 265 KMWETTQGKLIRELKGHGHWINSLALSTEY 294


>At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to U5 snRNP-specific 40 kDa protein (GI:3820594)
           [Homo sapiens]
          Length = 343

 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 32/95 (33%), Positives = 52/95 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +  NP    +I S S D+ + +W++  D  N+ +    L GH + I D+ 
Sbjct: 49  LSGHPSAVYTMKFNPA-GTLIASGSHDREIFLWRVHGDCKNFMV----LKGHKNAILDLH 103

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +SDG+  +S S DKT+R WD+  GK  ++  +H+
Sbjct: 104 WTSDGSQIVSASPDKTVRAWDVETGKQIKKMAEHS 138



 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 4/100 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   +T ++ +P     +L++  D  L VW + R         K   GH H     
Sbjct: 217 TLEGHQDTITGMSLSPD-GSYLLTNGMDNKLCVWDM-RPYAPQNRCVKIFEGHQHNFEKN 274

Query: 248 VL----SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L    S DG    +GS D+ + +WD  + +T  +   HT
Sbjct: 275 LLKCSWSPDGTKVTAGSSDRMVHIWDTTSRRTIYKLPGHT 314



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 26/102 (25%), Positives = 43/102 (42%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K    +  H+ +V       + P +I+S S D T  +W + +       P K     
Sbjct: 126 ETGKQIKKMAEHSSFVNSCCPTRRGPPLIISGSDDGTAKLWDMRQRGAIQTFPDK----- 180

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + I+ V  S   +   +G  D  +++WDL  G+ T   E H
Sbjct: 181 -YQITAVSFSDAADKIFTGGVDNDVKVWDLRKGEATMTLEGH 221



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 21/64 (32%), Positives = 30/64 (46%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I +   D  + VW L + E         L GH   I+ + LS DG+Y L+   D  L 
Sbjct: 193 DKIFTGGVDNDVKVWDLRKGEATM-----TLEGHQDTITGMSLSPDGSYLLTNGMDNKLC 247

Query: 305 LWDL 316
           +WD+
Sbjct: 248 VWDM 251



 Score = 35.1 bits (77), Expect = 0.038
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   +  +         I+S+S DKT+  W +       G   K++  HS F++   
Sbjct: 92  LKGHKNAILDLHWTSD-GSQIVSASPDKTVRAWDVET-----GKQIKKMAEHSSFVNSCC 145

Query: 251 LSSDGN-YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            +  G    +SGS D T +LWD+      + F D  ++
Sbjct: 146 PTRRGPPLIISGSDDGTAKLWDMRQRGAIQTFPDKYQI 183


>At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe]
          Length = 305

 Score = 58.0 bits (134), Expect = 5e-09
 Identities = 31/96 (32%), Positives = 53/96 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+ HNG + +   +P    +  +SS DKT+ +W +    + + + +K L GH  ++ D V
Sbjct: 207 LQAHNGHILKCLLSPANKYLATASS-DKTVKIWNV----DGFKL-EKVLTGHQRWVWDCV 260

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S DG + ++ S D T RLW + AGK  + ++ H K
Sbjct: 261 FSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHK 296



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGI--PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           M+++++   T  VW+L R +       P  +L  H+  I   +LS    Y  + S DKT+
Sbjct: 176 MVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTV 235

Query: 302 RLWDLAAGKTTRRFEDHTK 358
           ++W++   K  +    H +
Sbjct: 236 KIWNVDGFKLEKVLTGHQR 254



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           H++ +  V    D  +  SGS D T+++WDL A    + +E
Sbjct: 77  HTNNVMAVGFQCDAKWMYSGSEDGTVKIWDLRAPGCQKEYE 117


>At4g02730.1 68417.m00372 transducin family protein / WD-40 repeat
           family protein similar to C. elegans putative WD-repeat
           protein C14B1.4 (SP:Q17963)
          Length = 333

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 37/103 (35%), Positives = 55/103 (53%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           SG   ++KP+  +        TL GH   ++ +  +    +++ S+S DKT+I+W  T  
Sbjct: 24  SGNVPIYKPYRHLK-------TLEGHTAAISCVKFSND-GNLLASASVDKTMILWSAT-- 73

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
             NY +   R  GHS  ISD+  SSD +Y  S S D TLR+WD
Sbjct: 74  --NYSLIH-RYEGHSSGISDLAWSSDSHYTCSASDDCTLRIWD 113



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 28/93 (30%), Positives = 49/93 (52%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+  ++ +A +        S+S D TL +W    D  +     K L GH++F+  V  +
Sbjct: 83  GHSSGISDLAWSSD-SHYTCSASDDCTLRIW----DARSPYECLKVLRGHTNFVFCVNFN 137

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              N  +SGS+D+T+R+W++  GK  R  + H+
Sbjct: 138 PPSNLIVSGSFDETIRIWEVKTGKCVRMIKAHS 170



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 28/93 (30%), Positives = 47/93 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  +V  +  NP   ++I+S S D+T+ +W++       G   + +  HS  IS V 
Sbjct: 124 LRGHTNFVFCVNFNPP-SNLIVSGSFDETIRIWEVKT-----GKCVRMIKAHSMPISSVH 177

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            + DG+  +S S D + ++WD   G   +   D
Sbjct: 178 FNRDGSLIVSASHDGSCKIWDAKEGTCLKTLID 210



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 21/49 (42%), Positives = 26/49 (53%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           K L GH+  IS V  S+DGN   S S DKT+ LW         R+E H+
Sbjct: 37  KTLEGHTAAISCVKFSNDGNLLASASVDKTMILWSATNYSLIHRYEGHS 85



 Score = 35.1 bits (77), Expect = 0.038
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++G Y +SGS D  + LWDL A    +R E HT
Sbjct: 268 TNGKYIVSGSEDNCVYLWDLQARNILQRLEGHT 300


>At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta
           subunit (GB1) / GTP-binding protein beta subunit (AGB1)
           / transducin contains 7 WD-40 repeats (PF00400);
           identical to Guanine nucleotide-binding protein beta
           subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et
           al, PNAS 91:9954 (1994)
          Length = 347

 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+ +   L GH G+V+     P     +++SS D+T I+W +T          +   GH+
Sbjct: 145 TVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHT 204

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDH 352
             +  V +S S+ N+ +SGS D T RLWD  AA +  R F  H
Sbjct: 205 ADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRAVRTFHGH 247



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 25/92 (27%), Positives = 42/92 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +   P+  +S S D T  +W  TR  +      +  +GH   ++ V   
Sbjct: 202 GHTADVLSVSISGSNPNWFISGSCDSTARLWD-TRAASR---AVRTFHGHEGDVNTVKFF 257

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG    +GS D T RL+D+  G   + ++ H
Sbjct: 258 PDGYRFGTGSDDGTCRLYDIRTGHQLQVYQPH 289


>At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta
           subunit (GB1) / GTP-binding protein beta subunit (AGB1)
           / transducin contains 7 WD-40 repeats (PF00400);
           identical to Guanine nucleotide-binding protein beta
           subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et
           al, PNAS 91:9954 (1994)
          Length = 315

 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+ +   L GH G+V+     P     +++SS D+T I+W +T          +   GH+
Sbjct: 83  TVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHT 142

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDH 352
             +  V +S S+ N+ +SGS D T RLWD  AA +  R F  H
Sbjct: 143 ADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRAVRTFHGH 185



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDVV 250
           G NG VT IA +     +    + + T  VW     E   + G+ Q     H + IS + 
Sbjct: 230 GENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQD---SHRNRISCLG 286

Query: 251 LSSDGNYALSGSWDKTLRLW 310
           LS+DG+   +GSWD  L++W
Sbjct: 287 LSADGSALCTGSWDSNLKIW 306



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 25/92 (27%), Positives = 42/92 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +   P+  +S S D T  +W  TR  +      +  +GH   ++ V   
Sbjct: 140 GHTADVLSVSISGSNPNWFISGSCDSTARLWD-TRAASR---AVRTFHGHEGDVNTVKFF 195

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG    +GS D T RL+D+  G   + ++ H
Sbjct: 196 PDGYRFGTGSDDGTCRLYDIRTGHQLQVYQPH 227


>At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta
           subunit (GB1) / GTP-binding protein beta subunit (AGB1)
           / transducin contains 7 WD-40 repeats (PF00400);
           identical to Guanine nucleotide-binding protein beta
           subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et
           al, PNAS 91:9954 (1994)
          Length = 377

 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+ +   L GH G+V+     P     +++SS D+T I+W +T          +   GH+
Sbjct: 145 TVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHT 204

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDH 352
             +  V +S S+ N+ +SGS D T RLWD  AA +  R F  H
Sbjct: 205 ADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRAVRTFHGH 247



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDVV 250
           G NG VT IA +     +    + + T  VW     E   + G+ Q     H + IS + 
Sbjct: 292 GENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQD---SHRNRISCLG 348

Query: 251 LSSDGNYALSGSWDKTLRLW 310
           LS+DG+   +GSWD  L++W
Sbjct: 349 LSADGSALCTGSWDSNLKIW 368



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 25/92 (27%), Positives = 42/92 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +   P+  +S S D T  +W  TR  +      +  +GH   ++ V   
Sbjct: 202 GHTADVLSVSISGSNPNWFISGSCDSTARLWD-TRAASR---AVRTFHGHEGDVNTVKFF 257

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG    +GS D T RL+D+  G   + ++ H
Sbjct: 258 PDGYRFGTGSDDGTCRLYDIRTGHQLQVYQPH 289


>At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat
           family protein similar to Pop3 (GI:3434986)
           [Schizosaccharomyces pombe]; contains Pfam PF00400: WD
           domain, G-beta repeat (6 copies, 2 weak);
          Length = 312

 Score = 54.0 bits (124), Expect = 8e-08
 Identities = 31/96 (32%), Positives = 50/96 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+ HN  + +   +P    +  +SS DKT+ +W L    + + + +K L GH  ++ D  
Sbjct: 213 LQAHNSHILKCLLSPGNKYLATASS-DKTVKIWNL----DGFKL-EKVLTGHERWVWDCD 266

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S DG Y ++ S D T RLW + AGK    ++ H K
Sbjct: 267 FSMDGEYLVTASSDTTARLWSMRAGKEEMVYQAHRK 302



 Score = 34.7 bits (76), Expect = 0.051
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWK--LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           M+++++   T  VW+    R       P  +L  H+  I   +LS    Y  + S DKT+
Sbjct: 182 MVVAANDRGTCYVWRSLCERQTMTEFEPLHKLQAHNSHILKCLLSPGNKYLATASSDKTV 241

Query: 302 RLWDLAAGKTTRRFEDHTK 358
           ++W+L   K  +    H +
Sbjct: 242 KIWNLDGFKLEKVLTGHER 260



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 16/57 (28%), Positives = 26/57 (45%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           N  IP +    H+  +  V     G+   SGS D ++++WDL   +  R F   + V
Sbjct: 72  NPHIPVRNFVSHTKNVMAVGFQYTGHMMYSGSEDGSVKIWDLRVRECQREFRSVSPV 128


>At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80
           subunit, putative similar to contains 6 WD-40 repeats
           (PF00400); katanin p80 subunit (GI:3005601)
           [Strongylocentrotus purpuratus]
          Length = 974

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 32/102 (31%), Positives = 47/102 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+     GH    + +  +P + + + S S D  L VW    D    G  Q    GH
Sbjct: 37  EESKMVRAFTGHRSNCSAVEFHP-FGEFLASGSSDTNLRVW----DTRKKGCIQT-YKGH 90

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  IS +  S DG + +SG  D  +++WDL AGK    F+ H
Sbjct: 91  TRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCH 132



 Score = 34.3 bits (75), Expect = 0.067
 Identities = 24/97 (24%), Positives = 41/97 (42%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +A N +   ++L+ +    + +W L   +       +   GH    S V
Sbjct: 2   SLCGHTSPVDSVAFNSEEV-LVLAGASSGVIKLWDLEESKM-----VRAFTGHRSNCSAV 55

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G +  SGS D  LR+WD       + ++ HT+
Sbjct: 56  EFHPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTR 92


>At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat
           family protein similar to splicing factor hPRP17
           (gi|3283220); contains 7 WD-40 repeats (PF00400);similar
           to ESTs emb|F15435 and dbj|AUO62661
          Length = 573

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 28/96 (29%), Positives = 46/96 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  T  GH   V+ I   PK   ++LS+  D  + +W    D  N G   +   GH+  
Sbjct: 273 RLVHTWSGHTKGVSAIRFFPKQGHLLLSAGMDCKVKIW----DVYNSGKCMRTYMGHAKA 328

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + D+  S+DG+  L+  +DK ++ WD   G+    F
Sbjct: 329 VRDICFSNDGSKFLTAGYDKNIKYWDTETGQVISTF 364



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 2/96 (2%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH--SHFISDVVL 253
           H   +  I+ +P   + + + S D  ++++  TR+       +KR  GH  + +   V  
Sbjct: 454 HMHSMPSISVHPN-GNWLAAQSLDNQILIYS-TRERFQLN-KKKRFAGHIVAGYACQVNF 510

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           S DG + +SG  +     WD  + K  R  + H  V
Sbjct: 511 SPDGRFVMSGDGEGKCWFWDWKSCKVFRTLKCHNGV 546


>At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic
           regulator 1 (PRL1) identical to PP1/PP2A phosphatases
           pleiotropic regulator PRL1 (SP:Q42384) [Arabidopsis
           thaliana], PRL1 [Arabidopsis thaliana] GI:577733;
           contains Pfam PF00400: WD domain, G-beta repeat (7
           copies)
          Length = 486

 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 26/94 (27%), Positives = 45/94 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH GWV  +A +P   +   + S D+T+ +W +       G+ +  L GH   +  + 
Sbjct: 172 IQGHLGWVRSVAFDPSN-EWFCTGSADRTIKIWDVAT-----GVLKLTLTGHIEQVRGLA 225

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S+   Y  S   DK ++ WDL   K  R +  H
Sbjct: 226 VSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGH 259



 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 29/104 (27%), Positives = 44/104 (42%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  +  GH   V  +A +P   D++L+  RD    VW +      +      L GH
Sbjct: 248 EQNKVIRSYHGHLSGVYCLALHPTL-DVLLTGGRDSVCRVWDIRTKMQIFA-----LSGH 301

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + +  V         ++GS D T++ WDL  GKT      H K
Sbjct: 302 DNTVCSVFTRPTDPQVVTGSHDTTIKFWDLRYGKTMSTLTHHKK 345


>At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic
           regulator 2 (PRL2) identical to SP|Q39190 PP1/PP2A
           phosphatases pleiotropic regulator PRL2 {Arabidopsis
           thaliana}, GB:Q39190 from [Arabidopsis thaliana];
           contains Pfam PF00400: WD domain, G-beta repeat (7
           copies, 1 weak)
          Length = 479

 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 27/94 (28%), Positives = 45/94 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH GWV  +A +P   +   + S D+T+ +W +       G+ +  L GH   +  + 
Sbjct: 166 LQGHLGWVRSVAFDPSN-EWFCTGSADRTIKIWDVAT-----GVLKLTLTGHIGQVRGLA 219

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S+   Y  S   DK ++ WDL   K  R +  H
Sbjct: 220 VSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGH 253



 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 27/104 (25%), Positives = 45/104 (43%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  +  GH   V  +A +P   D++L+  RD    VW +      + +P      H
Sbjct: 242 EQNKVIRSYHGHLHGVYCLALHPTL-DVVLTGGRDSVCRVWDIRTKMQIFVLP------H 294

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              +  V+        ++GS D T++ WDL  GK+     +H K
Sbjct: 295 DSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKK 338


>At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2
           (beta prime), putative contains 7 WD-40 repeats
           (PF00400) (1 weak); similar to Coatomer beta' subunit
           (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606)
           [Homo sapiens]; similar to Coatomer beta' subunit
           (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus
           musculus]
          Length = 920

 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 28/93 (30%), Positives = 45/93 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+ +V Q+  NPK  +   S+S D+T+ +W L   + N+ +    L G +    D    
Sbjct: 140 GHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTL-DAHLKGVN--CVDYFTG 196

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            D  Y ++GS D T ++WD       +  E HT
Sbjct: 197 GDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHT 229



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H  ++  +A +P  P  +LSSS D  + +W    D     +  +   GHSH++  V  + 
Sbjct: 98  HADYIRCVAVHPTLP-YVLSSSDDMLIKLW----DWEKGWLCTQIFEGHSHYVMQVTFNP 152

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W+L +       + H K
Sbjct: 153 KDTNTFASASLDRTIKIWNLGSPDPNFTLDAHLK 186



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D T  VW    D       Q  L GH+H +S V    +    ++GS D T+R+W
Sbjct: 202 LITGSDDHTAKVW----DYQTKSCVQT-LEGHTHNVSAVSFHPELPIIITGSEDGTVRIW 256


>At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80
           subunit, putative contains 5 WD-40 repeats (PF00400);
           similar to katanin p80 subunit (GI:3005601)
           [Strongylocentrotus purpuratus]
          Length = 1180

 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 30/102 (29%), Positives = 48/102 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+     GH    + +  +P + + + S S D  L +W + +     G  Q    GH
Sbjct: 88  EEAKMVRAFTGHRSNCSAVEFHP-FGEFLASGSSDANLKIWDIRKK----GCIQT-YKGH 141

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           S  IS +  + DG + +SG  D  +++WDL AGK    F+ H
Sbjct: 142 SRGISTIRFTPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFH 183



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH+  +  V   S     L+G+    ++LWD+   K  R F  H
Sbjct: 54  LCGHTSAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGH 99



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/46 (28%), Positives = 22/46 (47%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GH    S V     G +  SGS D  L++WD+      + ++ H++
Sbjct: 98  GHRSNCSAVEFHPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHSR 143


>At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2
           (beta prime), putative contains 7 WD-40 repeats
           (PF00400) (1 weak); similar to (SP:O55029) Coatomer
           beta' subunit (Beta'-coat protein) (Beta'-COP) (p102)
           (SP:O55029) [Mus musculus]; similar to GI:298096 from
           [Homo sapiens]
          Length = 926

 Score = 50.8 bits (116), Expect = 7e-07
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T+ +W L   + N+      L  H   ++  D  
Sbjct: 140 GHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNF-----TLDAHQKGVNCVDYF 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              D  Y ++GS D T ++WD       +  E HT
Sbjct: 195 TGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHT 229



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H+ ++  +A +P  P  +LSSS D  + +W     E  +   Q    GHSH++  V  + 
Sbjct: 98  HSDYIRCVAVHPTLP-YVLSSSDDMLIKLWDW---EKGWACTQI-FEGHSHYVMQVTFNP 152

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W+L +       + H K
Sbjct: 153 KDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQK 186



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D T  VW    D       Q  L GH+H +S V    +    ++GS D T+R+W
Sbjct: 202 LITGSDDHTAKVW----DYQTKSCVQT-LEGHTHNVSAVCFHPELPIIITGSEDGTVRIW 256


>At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat
           family protein similar to TBP-associated factor
           (GI:1732075) [Homo sapiens] and to 100 kDa subunit of
           Pol II transcription factor (GI:1491718) {Homo sapiens];
           contains Pfam PF00400: WD domain, G-beta repeat (6
           copies)|8689032|gb|AV528749.1|AV528749
          Length = 666

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 32/93 (34%), Positives = 47/93 (50%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GHN  V     +P +     S S D+T  +W + R +     P + + GH   +SDV  
Sbjct: 457 KGHNYPVWDAQFSP-FGHYFASCSHDRTARIWSMDRIQ-----PLRIMAGH---LSDVDW 507

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS DKT+RLWD+  G+  R F  H
Sbjct: 508 HPNCNYIATGSSDKTVRLWDVQTGECVRIFIGH 540



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+G V     +P   D +LSSS D T+ +W    + N   +  K   GH++ + D  
Sbjct: 414 LLGHSGPVYSATFSPP-GDFVLSSSADTTIRLWSTKLNANL--VCYK---GHNYPVWDAQ 467

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S  G+Y  S S D+T R+W +
Sbjct: 468 FSPFGHYFASCSHDRTARIWSM 489



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 24/86 (27%), Positives = 41/86 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LR   G ++ +  +P   + I + S DKT+ +W +   E       +   GH   +  + 
Sbjct: 495 LRIMAGHLSDVDWHPNC-NYIATGSSDKTVRLWDVQTGEC-----VRIFIGHRSMVLSLA 548

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           +S DG Y  SG  D T+ +WDL+  +
Sbjct: 549 MSPDGRYMASGDEDGTIMMWDLSTAR 574



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 25/91 (27%), Positives = 42/91 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A +P    M  S   D T+++W L+            L GH+  +  +  S
Sbjct: 539 GHRSMVLSLAMSPDGRYMA-SGDEDGTIMMWDLSTARCI-----TPLMGHNSCVWSLSYS 592

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            +G+   SGS D T++LWD+ +     + E+
Sbjct: 593 GEGSLLASGSADCTVKLWDVTSSTKLTKAEE 623


>At3g05090.2 68416.m00553 transducin family protein / WD-40 repeat
           family protein contains seven G-protein beta WD-40
           repeats; similar to uncharacterized KIAA1449 protein
           (gi:7959157) [Homo sapiens]
          Length = 753

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 30/94 (31%), Positives = 45/94 (47%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +A N     M++S   +K L VW     +   G    +L GH+  +  ++L
Sbjct: 210 KGHKESVYALAMNDT-GTMLVSGGTEKVLRVW-----DPRTGSKSMKLRGHTDNVRVLLL 263

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S G + LSGS D  +RLWDL   +    +  HT
Sbjct: 264 DSTGRFCLSGSSDSMIRLWDLGQQRCLHTYAVHT 297


>At3g05090.1 68416.m00552 transducin family protein / WD-40 repeat
           family protein contains seven G-protein beta WD-40
           repeats; similar to uncharacterized KIAA1449 protein
           (gi:7959157) [Homo sapiens]
          Length = 753

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 30/94 (31%), Positives = 45/94 (47%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +A N     M++S   +K L VW     +   G    +L GH+  +  ++L
Sbjct: 210 KGHKESVYALAMNDT-GTMLVSGGTEKVLRVW-----DPRTGSKSMKLRGHTDNVRVLLL 263

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S G + LSGS D  +RLWDL   +    +  HT
Sbjct: 264 DSTGRFCLSGSSDSMIRLWDLGQQRCLHTYAVHT 297


>At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2
           (beta prime), putative contains 7 WD-40 repeats
           (PF00400) (1 weak); identical to coatomer protein
           complex, beta prime (beta'-COP) protein {Arabidopsis
           thaliana} (GI:9294445); similar to Coatomer beta'
           subunit (Beta'-coat protein) (Beta'-COP) (p102)
           (SP:P35606) [Homo sapiens]
          Length = 918

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T+ +W L   + N+      L  H   ++  D  
Sbjct: 140 GHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLGSPDPNF-----TLDAHQKGVNCVDYF 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              D  Y ++GS D T ++WD       +  + HT
Sbjct: 195 TGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHT 229



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H+ ++  +A +P  P  +LSSS D  + +W     EN +   Q    GHSH++  VV + 
Sbjct: 98  HSDYIRCVAVHPTLP-YVLSSSDDMLIKLWDW---ENGWACTQI-FEGHSHYVMQVVFNP 152

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W+L +       + H K
Sbjct: 153 KDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQK 186



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D T  VW    D       Q  L GH+H +S V    +    ++GS D T+R+W
Sbjct: 202 LITGSDDHTAKVW----DYQTKSCVQT-LDGHTHNVSAVCFHPELPIIITGSEDGTVRIW 256


>At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2
           (beta prime), putative contains 7 WD-40 repeats
           (PF00400) (1 weak); identical to coatomer protein
           complex, beta prime (beta'-COP) protein {Arabidopsis
           thaliana} (GI:9294445); similar to Coatomer beta'
           subunit (Beta'-coat protein) (Beta'-COP) (p102)
           (SP:P35606) [Homo sapiens]
          Length = 918

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T+ +W L   + N+      L  H   ++  D  
Sbjct: 140 GHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLGSPDPNF-----TLDAHQKGVNCVDYF 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              D  Y ++GS D T ++WD       +  + HT
Sbjct: 195 TGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHT 229



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H+ ++  +A +P  P  +LSSS D  + +W     EN +   Q    GHSH++  VV + 
Sbjct: 98  HSDYIRCVAVHPTLP-YVLSSSDDMLIKLWDW---ENGWACTQI-FEGHSHYVMQVVFNP 152

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W+L +       + H K
Sbjct: 153 KDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQK 186



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D T  VW    D       Q  L GH+H +S V    +    ++GS D T+R+W
Sbjct: 202 LITGSDDHTAKVW----DYQTKSCVQT-LDGHTHNVSAVCFHPELPIIITGSEDGTVRIW 256


>At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2
           (beta prime), putative contains 7 WD-40 repeats
           (PF00400) (1 weak); identical to coatomer protein
           complex, beta prime (beta'-COP) protein {Arabidopsis
           thaliana} (GI:9294445); similar to Coatomer beta'
           subunit (Beta'-coat protein) (Beta'-COP) (p102)
           (SP:P35606) [Homo sapiens]
          Length = 909

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T+ +W L   + N+      L  H   ++  D  
Sbjct: 140 GHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLGSPDPNF-----TLDAHQKGVNCVDYF 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              D  Y ++GS D T ++WD       +  + HT
Sbjct: 195 TGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHT 229



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H+ ++  +A +P  P  +LSSS D  + +W     EN +   Q    GHSH++  VV + 
Sbjct: 98  HSDYIRCVAVHPTLP-YVLSSSDDMLIKLWDW---ENGWACTQI-FEGHSHYVMQVVFNP 152

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W+L +       + H K
Sbjct: 153 KDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQK 186



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D T  VW    D       Q  L GH+H +S V    +    ++GS D T+R+W
Sbjct: 202 LITGSDDHTAKVW----DYQTKSCVQT-LDGHTHNVSAVCFHPELPIIITGSEDGTVRIW 256


>At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat
           family protein contains Pfam profile: PF00400 WD domain,
           G-beta repeat (10 copies); similar to WD-repeat protein
           3 (SP:Q9UNX4) [Homo sapiens]
          Length = 955

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 28/79 (35%), Positives = 41/79 (51%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H G VT +  N K   M+ S S+D  +I+W +  +   +     RL GH   ++D+V   
Sbjct: 105 HKGAVTALRYN-KVGSMLASGSKDNDIILWDVVGESGLF-----RLRGHRDQVTDLVFLD 158

Query: 260 DGNYALSGSWDKTLRLWDL 316
            G   +S S DK LR+WDL
Sbjct: 159 GGKKLVSSSKDKFLRVWDL 177



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           LYGH   +  + +SSDG   ++GS DK L++W L  G
Sbjct: 578 LYGHKLPVMCIDISSDGELIVTGSQDKNLKIWGLDFG 614



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 23/89 (25%), Positives = 43/89 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ++LK   +L GH   V  I  +    ++I++ S+DK L +W L     ++G   K ++ H
Sbjct: 570 DSLKFYLSLYGHKLPVMCIDISSD-GELIVTGSQDKNLKIWGL-----DFGDCHKSIFAH 623

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              +  V    + +Y  S   D+ ++ WD
Sbjct: 624 GDSVMGVKFVRNTHYLFSIGKDRLVKYWD 652



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L GH   I  + +S+ G++ ++GS D+++R WD
Sbjct: 662 LEGHHAEIWCLAISNRGDFLVTGSHDRSMRRWD 694


>At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat
           family protein similar to katanin p80 subunit
           [Strongylocentrotus purpuratus] GI:3005601; contains
           Pfam profile PF00400: WD domain, G-beta repeat
          Length = 871

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 27/102 (26%), Positives = 47/102 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH      +  +P + +   S S D  L +W + +    +        GH
Sbjct: 182 EEAKVVRTLTGHRSNCVSVNFHP-FGEFFASGSLDTNLKIWDIRKKGCIHTYK-----GH 235

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  ++ +  + DG + +SG  D  +++WDL AGK    F+ H
Sbjct: 236 TRGVNVLRFTPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSH 277



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LYGHS  I  V   +      +G+   T++LWDL   K  R    H
Sbjct: 148 LYGHSSGIDSVTFDASEGLVAAGAASGTIKLWDLEEAKVVRTLTGH 193



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 20/97 (20%), Positives = 40/97 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+  +  +  +     ++ + +   T+ +W L   +       + L GH      V
Sbjct: 147 SLYGHSSGIDSVTFDAS-EGLVAAGAASGTIKLWDLEEAK-----VVRTLTGHRSNCVSV 200

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G +  SGS D  L++WD+        ++ HT+
Sbjct: 201 NFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTR 237



 Score = 28.3 bits (60), Expect = 4.4
 Identities = 23/83 (27%), Positives = 31/83 (37%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH   V  +   P     I+S   D  + VW LT      G        H   I  +
Sbjct: 231 TYKGHTRGVNVLRFTPD-GRWIVSGGEDNVVKVWDLTA-----GKLLHEFKSHEGKIQSL 284

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
                     +GS DKT++ WDL
Sbjct: 285 DFHPHEFLLATGSADKTVKFWDL 307


>At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           similar to Will die slowly protein
           (SP:Q9V3J8)[Drosophila melanogaster]
          Length = 511

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 24/77 (31%), Positives = 42/77 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ S S+D  + +W++       G+  +R   HS  ++ +  S DG+  LS S+D+T R
Sbjct: 276 EMLASGSQDGKIKIWRIRT-----GVCIRRFDAHSQGVTSLSFSRDGSQLLSTSFDQTAR 330

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  L +GK  + F  HT
Sbjct: 331 IHGLKSGKLLKEFRGHT 347



 Score = 34.7 bits (76), Expect = 0.051
 Identities = 21/78 (26%), Positives = 42/78 (53%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  VT ++ + +    +LS+S D+T  +  L       G   K   GH+ +++  + +S
Sbjct: 304 HSQGVTSLSFS-RDGSQLLSTSFDQTARIHGLKS-----GKLLKEFRGHTSYVNHAIFTS 357

Query: 260 DGNYALSGSWDKTLRLWD 313
           DG+  ++ S D T+++WD
Sbjct: 358 DGSRIITASSDCTVKVWD 375



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 5/81 (6%)
 Frame = +2

Query: 131 ILSSSRDKTLIVW-----KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDK 295
           + SSS D  + VW     KL +D   Y   +  +  H   +  +  S D     SGS D 
Sbjct: 228 LASSSVDGFIEVWDYISGKLKKDLQ-YQADESFMM-HDDPVLCIDFSRDSEMLASGSQDG 285

Query: 296 TLRLWDLAAGKTTRRFEDHTK 358
            +++W +  G   RRF+ H++
Sbjct: 286 KIKIWRIRTGVCIRRFDAHSQ 306


>At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 709

 Score = 47.2 bits (107), Expect = 9e-06
 Identities = 26/83 (31%), Positives = 47/83 (56%), Gaps = 1/83 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH G +  ++ + K    +LSSS D+T+ +W++   +        R++ H  F++ V  
Sbjct: 360 RGHTGEILDLSWSEK--GFLLSSSVDETVRLWRVGSSDECI-----RVFSHKSFVTCVAF 412

Query: 254 SS-DGNYALSGSWDKTLRLWDLA 319
           +  D NY +SGS D  +R+WD++
Sbjct: 413 NPVDDNYFISGSIDGKVRIWDVS 435



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           PQ    GH+  I D+  S  G + LS S D+T+RLW + +     R   H
Sbjct: 355 PQHEFRGHTGEILDLSWSEKG-FLLSSSVDETVRLWRVGSSDECIRVFSH 403


>At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           katanin p80 subunit (GI:3005601) [Strongylocentrotus
           purpuratus]
          Length = 836

 Score = 47.2 bits (107), Expect = 9e-06
 Identities = 27/102 (26%), Positives = 47/102 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH      +  +P + +   S S D  L +W + +    +        GH
Sbjct: 89  EEAKIVRTLTGHRSNCISVDFHP-FGEFFASGSLDTNLKIWDIRKKGCIHTYK-----GH 142

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  ++ +  + DG + +SG  D  +++WDL AGK    F+ H
Sbjct: 143 TRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSH 184



 Score = 34.7 bits (76), Expect = 0.051
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LYGHS  I  V   +      +G+   T++LWDL   K  R    H
Sbjct: 55  LYGHSSGIDSVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGH 100



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           + L GH      V     G +  SGS D  L++WD+        ++ HT+
Sbjct: 95  RTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTR 144


>At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           katanin p80 subunit (GI:3005601) [Strongylocentrotus
           purpuratus]
          Length = 837

 Score = 47.2 bits (107), Expect = 9e-06
 Identities = 27/102 (26%), Positives = 47/102 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH      +  +P + +   S S D  L +W + +    +        GH
Sbjct: 89  EEAKIVRTLTGHRSNCISVDFHP-FGEFFASGSLDTNLKIWDIRKKGCIHTYK-----GH 142

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  ++ +  + DG + +SG  D  +++WDL AGK    F+ H
Sbjct: 143 TRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSH 184



 Score = 34.7 bits (76), Expect = 0.051
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LYGHS  I  V   +      +G+   T++LWDL   K  R    H
Sbjct: 55  LYGHSSGIDSVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGH 100



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           + L GH      V     G +  SGS D  L++WD+        ++ HT+
Sbjct: 95  RTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTR 144


>At4g28450.1 68417.m04071 transducin family protein / WD-40 repeat
           family protein SOF1 (involved in rRNA processing)
           protein-yeast
          Length = 442

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/84 (30%), Positives = 41/84 (48%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G + GH   V+ +A NP Y   I S+S D  + +W ++        P     GH   +  
Sbjct: 50  GAMDGHRDGVSCMAKNPNYLKGIFSASMDGDIRLWDISSRRTVCQFP-----GHQGAVRG 104

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
           +  S+DGN  +S   D T+RLW++
Sbjct: 105 LTASTDGNVLVSCGTDCTVRLWNV 128



 Score = 28.3 bits (60), Expect = 4.4
 Identities = 13/28 (46%), Positives = 15/28 (53%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           V  S D  Y +SGS D  LRLW   A +
Sbjct: 328 VKYSCDATYVISGSDDTNLRLWKAKASE 355


>At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 647

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 31/97 (31%), Positives = 54/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH G +  ++ + K    +LSSS D+T+ +W++  DE        R + H++F++ V  
Sbjct: 319 KGHIGEILDLSWSEK--GYLLSSSVDETVRLWRVGCDEC------LRTFTHNNFVTCVAF 370

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  D NY +SGS D  +R+WD+    T  R  D+T +
Sbjct: 371 NPVDDNYFISGSIDGKVRIWDV----TRCRVVDYTDI 403



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLR 304
           L  S D T +V   T     + I +K L+   GH   I D+  S  G Y LS S D+T+R
Sbjct: 292 LRKSSDSTCVVLPPTI----FSISEKPLHEFKGHIGEILDLSWSEKG-YLLSSSVDETVR 346

Query: 305 LWDLAAGKTTRRF 343
           LW +   +  R F
Sbjct: 347 LWRVGCDECLRTF 359


>At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 647

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 31/97 (31%), Positives = 54/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH G +  ++ + K    +LSSS D+T+ +W++  DE        R + H++F++ V  
Sbjct: 319 KGHIGEILDLSWSEK--GYLLSSSVDETVRLWRVGCDEC------LRTFTHNNFVTCVAF 370

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  D NY +SGS D  +R+WD+    T  R  D+T +
Sbjct: 371 NPVDDNYFISGSIDGKVRIWDV----TRCRVVDYTDI 403



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLR 304
           L  S D T +V   T     + I +K L+   GH   I D+  S  G Y LS S D+T+R
Sbjct: 292 LRKSSDSTCVVLPPTI----FSISEKPLHEFKGHIGEILDLSWSEKG-YLLSSSVDETVR 346

Query: 305 LWDLAAGKTTRRF 343
           LW +   +  R F
Sbjct: 347 LWRVGCDECLRTF 359


>At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha,
           putative contains Pfam PF00400: WD domain, G-beta
           repeat; similar to Coatomer alpha subunit (Alpha-coat
           protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621)
           [Homo sapiens]
          Length = 1216

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 3/126 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++  +  + +YP  I+S+S D+T+ +W   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTVQFHHEYP-WIVSASDDQTIRIWNW-QSRTCVSV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAA--GKTTRRFEDHTKV*Q-NS*FC*GVNADYALKII 418
                 +  +S S D+T+R+WD+ A   KT    +D  ++ Q NS    GV+A   +K +
Sbjct: 142 SFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMRLTQMNSDLFGGVDA--IVKYV 199

Query: 419 LSAYAR 436
           L  + R
Sbjct: 200 LEGHDR 205



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 23/81 (28%), Positives = 43/81 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V   A +P  P +I+S + D+ + +W++   +         L GH + +S V+
Sbjct: 200 LEGHDRGVNWAAFHPTLP-LIVSGADDRQVKLWRMNETK---AWEVDTLRGHMNNVSSVM 255

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
             +  +  +S S DK++R+WD
Sbjct: 256 FHAKQDIIVSNSEDKSIRVWD 276



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +2

Query: 38  KMSETLKLR-GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +M+ET      TLRGH   V+ +  + K  D+I+S+S DK++ VW  T+
Sbjct: 232 RMNETKAWEVDTLRGHMNNVSSVMFHAKQ-DIIVSNSEDKSIRVWDATK 279


>At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat
           family protein contains 8 WD-40 repeats (PF00400);
           similar to transducin homolog sazD - Homo sapiens,
           EMBL:U02609
          Length = 876

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 26/101 (25%), Positives = 47/101 (46%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK R  +  H+  +  +A   +   ++ + S D+T  +W+L        +    L GH  
Sbjct: 489 LKTRSVVAAHDKDINSVAV-ARNDSLVCTGSEDRTASIWRLPDL-----VHVVTLKGHKR 542

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            I  V  S+     ++ S DKT+++W ++ G   + FE HT
Sbjct: 543 RIFSVEFSTVDQCVMTASGDKTVKIWAISDGSCLKTFEGHT 583



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ETLK   + +GH G V  +A +     ++ ++  D+ ++VW +     + G       GH
Sbjct: 90  ETLKCIRSWKGHEGPVMGMACHAS-GGLLATAGADRKVLVWDV-----DGGFCTHYFRGH 143

Query: 227 SHFISDVVLSSDGN--YALSGSWDKTLRLWDLAAGKTTRR 340
              +S ++   D N    +SGS D T+R+WDL A  T ++
Sbjct: 144 KGVVSSILFHPDSNKNILISGSDDATVRVWDLNAKNTEKK 183



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNP-KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           RGH G V+ I  +P    ++++S S D T+ VW L   +N        +  H   ++ + 
Sbjct: 141 RGHKGVVSSILFHPDSNKNILISGSDDATVRVWDLNA-KNTEKKCLAIMEKHFSAVTSIA 199

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
           LS DG    S   DK + LWDL
Sbjct: 200 LSEDGLTLFSAGRDKVVNLWDL 221



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 5/89 (5%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL--TRDENNYGIPQKR---LYGHS 229
           G   GHNG +  +A   K     +S S D+TL VW L    +++   I  K    +  H 
Sbjct: 440 GVGTGHNGDILAVAFAKKSFSFFVSGSGDRTLKVWSLDGISEDSEEPINLKTRSVVAAHD 499

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             I+ V ++ + +   +GS D+T  +W L
Sbjct: 500 KDINSVAVARNDSLVCTGSEDRTASIWRL 528



 Score = 34.7 bits (76), Expect = 0.051
 Identities = 21/95 (22%), Positives = 43/95 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   +  +  +      ++++S DKT+ +W ++      G   K   GH+  +   
Sbjct: 536 TLKGHKRRIFSVEFST-VDQCVMTASGDKTVKIWAISD-----GSCLKTFEGHTSSVLRA 589

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +DG   +S   D  L+LW++   +    ++ H
Sbjct: 590 SFITDGTQFVSCGADGLLKLWNVNTSECIATYDQH 624



 Score = 33.9 bits (74), Expect = 0.089
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIAT--NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T+     L GH   V  + T  +     +I++ S+DKT+ +W  T  ++  G+      G
Sbjct: 390 TMSCSYVLAGHKEVVLSLDTCVSSSGNVLIVTGSKDKTVRLWNAT-SKSCIGVGT----G 444

Query: 224 HSHFISDVVLSSDG-NYALSGSWDKTLRLWDL 316
           H+  I  V  +    ++ +SGS D+TL++W L
Sbjct: 445 HNGDILAVAFAKKSFSFFVSGSGDRTLKVWSL 476



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 22/101 (21%), Positives = 43/101 (42%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++ T+ G +  +T +A +P    ++ S+   + + VW L   E    I   +  GH   +
Sbjct: 52  VKSTIEGESDTLTALALSPD-DKLLFSAGHSRQIRVWDL---ETLKCIRSWK--GHEGPV 105

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             +   + G    +   D+ + +WD+  G  T  F  H  V
Sbjct: 106 MGMACHASGGLLATAGADRKVLVWDVDGGFCTHYFRGHKGV 146


>At5g15550.2 68418.m01821 transducin family protein / WD-40 repeat
           family protein similar to YTM1 - Homo sapiens,
           EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta
           repeat (7 copies,1 weak);
          Length = 402

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 7/88 (7%)
 Frame = +2

Query: 71  LRGHNGWVTQIA---TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY----GHS 229
           L GH+G ++ +A   +N      + ++S+D+TL ++K    E+     + R Y    GH 
Sbjct: 146 LEGHSGAISSVALVNSNDAETVTVATASKDRTLRLFKFDPAESVDSTTKVRAYKILRGHK 205

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWD 313
             +  V     GN   S SWD T+ LW+
Sbjct: 206 ASVQSVSAQKSGNMVCSSSWDCTINLWN 233



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 37/124 (29%), Positives = 52/124 (41%), Gaps = 22/124 (17%)
 Frame = +2

Query: 23  FKPFSKMSETLKLRG--TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT------ 178
           F P   +  T K+R    LRGH   V  ++   K  +M+ SSS D T+ +W         
Sbjct: 183 FDPAESVDSTTKVRAYKILRGHKASVQSVSAQ-KSGNMVCSSSWDCTINLWNTNESTSEG 241

Query: 179 -------RDENNY-------GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
                  R  NN        G     L GH+  +S VV   + +   S SWD ++R WD+
Sbjct: 242 ESVSVKKRKGNNQAEESQSEGEAVTSLVGHTQCVSSVVWP-EHDVIYSSSWDHSVRRWDV 300

Query: 317 AAGK 328
             GK
Sbjct: 301 ETGK 304


>At5g15550.1 68418.m01820 transducin family protein / WD-40 repeat
           family protein similar to YTM1 - Homo sapiens,
           EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta
           repeat (7 copies,1 weak);
          Length = 433

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 7/88 (7%)
 Frame = +2

Query: 71  LRGHNGWVTQIA---TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY----GHS 229
           L GH+G ++ +A   +N      + ++S+D+TL ++K    E+     + R Y    GH 
Sbjct: 146 LEGHSGAISSVALVNSNDAETVTVATASKDRTLRLFKFDPAESVDSTTKVRAYKILRGHK 205

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWD 313
             +  V     GN   S SWD T+ LW+
Sbjct: 206 ASVQSVSAQKSGNMVCSSSWDCTINLWN 233



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 37/124 (29%), Positives = 52/124 (41%), Gaps = 22/124 (17%)
 Frame = +2

Query: 23  FKPFSKMSETLKLRG--TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT------ 178
           F P   +  T K+R    LRGH   V  ++   K  +M+ SSS D T+ +W         
Sbjct: 183 FDPAESVDSTTKVRAYKILRGHKASVQSVSAQ-KSGNMVCSSSWDCTINLWNTNESTSEG 241

Query: 179 -------RDENNY-------GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
                  R  NN        G     L GH+  +S VV   + +   S SWD ++R WD+
Sbjct: 242 ESVSVKKRKGNNQAEESQSEGEAVTSLVGHTQCVSSVVWP-EHDVIYSSSWDHSVRRWDV 300

Query: 317 AAGK 328
             GK
Sbjct: 301 ETGK 304


>At1g04510.1 68414.m00442 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           similar to cell cycle control protein cwf8 (SP:O14011)
           [Schizosaccharomyces pombe (Fission yeast)]
          Length = 523

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 29/90 (32%), Positives = 47/90 (52%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           ++  TL GH+  VT I       D++L++S DKT+ +W  + D  NY   +  L  HS  
Sbjct: 255 QILSTLTGHSKKVTSIKFVGD-TDLVLTASSDKTVRIWGCSED-GNY-TSRHTLKDHSAE 311

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +  V + +   Y +S S D T   +DL++G
Sbjct: 312 VRAVTVHATNKYFVSASLDSTWCFYDLSSG 341



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA-GKTTRR--FEDHT 355
           L GHS  ++ +    D +  L+ S DKT+R+W  +  G  T R   +DH+
Sbjct: 260 LTGHSKKVTSIKFVGDTDLVLTASSDKTVRIWGCSEDGNYTSRHTLKDHS 309


>At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to will die slowly protein (WDS) (SP:Q9V3J8)
           [Drosophila melanogaster]
          Length = 589

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR-LYGHSHFISDVVLSSDG 265
           W  Q + N KY   + SSS+D+T I+W+++ D +   I  K  L GH   +  ++ S D 
Sbjct: 278 WFLQFSHNGKY---LASSSKDQTAIIWEISADGH---ISLKHTLVGHHKPVIAILWSPDD 331

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFE 346
              L+   ++ +R WD+ +G     +E
Sbjct: 332 RQVLTCGAEEVIRRWDVDSGDCVHMYE 358



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 24/73 (32%), Positives = 36/73 (49%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L GH G V  ++ +P    M+ S+S D T+ +W L R  N     +K + G S
Sbjct: 520 TGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDR-INQQNQKKKLVQGSS 578

Query: 230 HFISDVVLSSDGN 268
              + V+   +GN
Sbjct: 579 S--NGVIHRCNGN 589



 Score = 28.3 bits (60), Expect = 4.4
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +2

Query: 119 YPDM--ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           YPD   I++   D+++ +W L   E      Q+     +  +SD+ ++ DG + +S   D
Sbjct: 370 YPDGQGIIAGMTDRSICMWDLDGREKECWKGQR-----TQKVSDIAMTDDGKWLVSVCKD 424

Query: 293 KTLRLWDLAA 322
             + L+D  A
Sbjct: 425 SVISLFDREA 434


>At2g33340.2 68415.m04087 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           similar to cell cycle control protein cwf8 (SP:O14011)
           [Schizosaccharomyces pombe (Fission yeast)]
          Length = 537

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 30/101 (29%), Positives = 49/101 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           ++  TL GH+  VT +       D++L++S DKT+ +W+   D  NY      L  HS  
Sbjct: 255 QILSTLTGHSKKVTSVKFVGD-SDLVLTASADKTVRIWRNPGD-GNYACGY-TLNDHSAE 311

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +  V +     Y +S S D T   +DL++G    +  D +K
Sbjct: 312 VRAVTVHPTNKYFVSASLDGTWCFYDLSSGSCLAQVSDDSK 352


>At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           similar to cell cycle control protein cwf8 (SP:O14011)
           [Schizosaccharomyces pombe (Fission yeast)]
          Length = 565

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 30/101 (29%), Positives = 49/101 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           ++  TL GH+  VT +       D++L++S DKT+ +W+   D  NY      L  HS  
Sbjct: 255 QILSTLTGHSKKVTSVKFVGD-SDLVLTASADKTVRIWRNPGD-GNYACGY-TLNDHSAE 311

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +  V +     Y +S S D T   +DL++G    +  D +K
Sbjct: 312 VRAVTVHPTNKYFVSASLDGTWCFYDLSSGSCLAQVSDDSK 352


>At5g13480.1 68418.m01554 WD-40 repeat family protein similar to
           WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens};
           contains 3 weak Pfam PF00400: WD domain, G-beta repeats;
          Length = 711

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = +2

Query: 77  GHNGW-VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           GH GW V  +  +P    +++S  +D+ + +W  TR     G     L+GH + +  V  
Sbjct: 266 GH-GWDVKSVDWHPT-KSLLVSGGKDQLVKLWD-TRS----GRELCSLHGHKNIVLSVKW 318

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           + +GN+ L+ S D+ ++L+D+   K  + F  HTK
Sbjct: 319 NQNGNWLLTASKDQIIKLYDIRTMKELQSFRGHTK 353



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 24/87 (27%), Positives = 39/87 (44%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+K   + RGH   VT +A +P + +  +S S D ++  W +  +     IP      H 
Sbjct: 341 TMKELQSFRGHTKDVTSLAWHPCHEEYFVSGSSDGSICHWIVGHENPQIEIPN----AHD 396

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + D+     G    SGS D T + W
Sbjct: 397 NSVWDLAWHPIGYLLCSGSNDHTTKFW 423


>At3g18860.2 68416.m02396 transducin family protein / WD-40 repeat
           family protein contains seven G-protein beta WD-40
           repeats; similar to phospholipase a-2-activating protein
           SP:P27612 from [Mus musculus]
          Length = 760

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 5/104 (4%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KLR  L GH+  V  I       + I +SSRD+T+ VW L   +      +K L GH+ F
Sbjct: 11  KLRCELHGHDDDVRGICVCND--ENIATSSRDRTIRVWSLDPSDKRKYTSEKILLGHTSF 68

Query: 236 ISDVV-LSSDGNY----ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +  +     Y     +SGS D  + +W+L  G+  +  + H
Sbjct: 69  VGPLAWIPPTDEYPEGRLVSGSMDTFVFVWNLMNGENIQTLKGH 112


>At3g18860.1 68416.m02395 transducin family protein / WD-40 repeat
           family protein contains seven G-protein beta WD-40
           repeats; similar to phospholipase a-2-activating protein
           SP:P27612 from [Mus musculus]
          Length = 760

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 5/104 (4%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KLR  L GH+  V  I       + I +SSRD+T+ VW L   +      +K L GH+ F
Sbjct: 11  KLRCELHGHDDDVRGICVCND--ENIATSSRDRTIRVWSLDPSDKRKYTSEKILLGHTSF 68

Query: 236 ISDVV-LSSDGNY----ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +  +     Y     +SGS D  + +W+L  G+  +  + H
Sbjct: 69  VGPLAWIPPTDEYPEGRLVSGSMDTFVFVWNLMNGENIQTLKGH 112


>At2g41500.1 68415.m05127 WD-40 repeat family protein / small
           nuclear ribonucleoprotein Prp4p-related similar to U4/U6
           small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo
           sapiens}; contains Pfam PF00400: WD domain, G-beta
           repeat (7 copies)|19877698|gb|AU238529.1|AU238529
          Length = 554

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 28/97 (28%), Positives = 43/97 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   + ++A +P     + ++S DKT  +W +     N G       GHS  +  +
Sbjct: 334 TFEGHLDRLARVAFHPS-GKYLGTTSYDKTWRLWDI-----NTGAELLLQEGHSRSVYGI 387

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               DG  A S   D   R+WDL  G++   F+ H K
Sbjct: 388 AFQQDGALAASCGLDSLARVWDLRTGRSILVFQGHIK 424



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 19/77 (24%), Positives = 39/77 (50%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V+Q+   P+    + ++S D  + +W   RD +      K L GH   ++ + +++
Sbjct: 464 HANLVSQVKYEPQEGYFLATASYDMKVNIWS-GRDFSLV----KSLAGHESKVASLDITA 518

Query: 260 DGNYALSGSWDKTLRLW 310
           D +   + S D+T++LW
Sbjct: 519 DSSCIATVSHDRTIKLW 535



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/37 (35%), Positives = 18/37 (48%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           GH   +  V  S +G +  SG  D   R+WDL   K+
Sbjct: 421 GHIKPVFSVNFSPNGYHLASGGEDNQCRIWDLRMRKS 457


>At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2
           protein (ZFWD2), putative 99.8% identical to zfwd2
           protein (GI:12057166) [Arabidopsis thaliana]; contains 6
           copies (2 weak) Pfam PF00400: WD domain, G-beta repeat;
           contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type
           (and similar) domain
          Length = 437

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 47/93 (50%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           +G V Q+ +     D++ + ++D +++ W+     N +  P   L GH+  ++ V L   
Sbjct: 227 SGPVGQVYSLVVGTDLLFAGTQDGSILAWRYNAATNCFE-PSASLTGHT--LAVVTLYVG 283

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            N   SGS DKT+++W L   +  +   DH+ V
Sbjct: 284 ANRLYSGSMDKTIKVWSLDNLQCIQTLTDHSSV 316



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 17/41 (41%), Positives = 26/41 (63%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           +L GH   +S + L S  +   +GS D+TLR+WD A+G+ T
Sbjct: 146 QLDGHEKLVSGIALPSGSDKLYTGSKDETLRVWDCASGQCT 186



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           E+  L   L GH   V+ IA  P   D + + S+D+TL VW
Sbjct: 139 ESFALLTQLDGHEKLVSGIAL-PSGSDKLYTGSKDETLRVW 178


>At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat
           family protein HIRA protein, Drosophila melanogaster,
           PID:e1250847
          Length = 318

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 25/101 (24%), Positives = 53/101 (52%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G + +++ F+  SE++ +   LRGH   V  ++ N     ++ +  RDK++ +W++  +E
Sbjct: 70  GNTCVWENFATDSESVSV---LRGHESEVKSVSWNAS-GSLLATCGRDKSVWIWEIQPEE 125

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++       L GHS  +  V+     +   S S+D T+++W
Sbjct: 126 DDEFDTIAVLTGHSEDVKMVLWHPTMDVLFSCSYDNTIKIW 166



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK 172
           L GH   V  +A NP    +I S S DKT+ +W+
Sbjct: 16  LEGHTDRVWNVAWNPAADGVIASCSADKTVRIWE 49


>At2g16405.1 68415.m01878 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to WD-repeat protein 13 (SP:Q9H1Z4) [Homo
           sapiens]
          Length = 482

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 19/43 (44%), Positives = 27/43 (62%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           K+L GHS  ++D   SS+  Y  S S DKT+R+W+L+ G   R
Sbjct: 210 KQLTGHSKDVTDFDFSSNNQYIASSSLDKTIRVWELSRGVCIR 252



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 4/97 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           L GH+  VT    ++N +Y   I SSS DKT+ VW+L+R     G+  + +YG S     
Sbjct: 212 LTGHSKDVTDFDFSSNNQY---IASSSLDKTIRVWELSR-----GVCIRVIYGISPQYCI 263

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR--FED 349
                + N+  +G+ +K L +++ + G+  ++  FED
Sbjct: 264 RFHPVNNNFLSAGNANKELTVFNFSTGRIIKKLLFED 300


>At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to Will die slowly protein (SP:Q9V3J8) [Fruit
           fly] {Drosophila m.]
          Length = 299

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 27/94 (28%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH G V     N    +  L+  +D+T+ +W   R     GI  K    H   + DV 
Sbjct: 14  LKGHEGAVLAARFNGD-GNYALTCGKDRTIRLWNPHR-----GILIKTYKSHGREVRDVH 67

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++SD     S   D+ +  WD++ G+  R+F  H
Sbjct: 68  VTSDNAKFCSCGGDRQVYYWDVSTGRVIRKFRGH 101



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ + +S+DGN  L+G  D TLRL D   G+  + ++ H
Sbjct: 187 VNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGH 225



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK 172
           K+    R H+  VT ++ +PK  D +L+SS D T+ VWK
Sbjct: 261 KVLSKFRAHDLVVTSVSYHPK-EDCMLTSSVDGTIRVWK 298



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 9/35 (25%), Positives = 20/35 (57%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           ++  GH   ++ V  +   +  +S  +D++LR+WD
Sbjct: 96  RKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWD 130


>At4g29830.1 68417.m04246 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400); G
           protein beta subunit-like protein, Schistosoma mansoni,
           gb:U30261
          Length = 321

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 29/99 (29%), Positives = 45/99 (45%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   L GHN  V  +  +P  P ++ S S D  + +      +   G     + GH+ +
Sbjct: 191 KLLHQLEGHNMPVRSLVFSPVDPRVLFSGSDDGHVNMHD-AEGKTLLG----SMSGHTSW 245

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V  S DG    +GS D+T+RLWDL      +   +H
Sbjct: 246 VLSVDASPDGGAIATGSSDRTVRLWDLKMRAAIQTMSNH 284



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           +E   L G++ GH  WV  +  +P     I + S D+T+ +W L
Sbjct: 230 AEGKTLLGSMSGHTSWVLSVDASPD-GGAIATGSSDRTVRLWDL 272


>At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 654

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 25/83 (30%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH G V  I+ +    + +LS+S DKT+ +WK+  ++   G+     + H+ +++ V  
Sbjct: 325 RGHTGEVLDISWSKD--NYLLSASMDKTVRLWKVGSNDC-LGV-----FAHNSYVTSVQF 376

Query: 254 SS-DGNYALSGSWDKTLRLWDLA 319
           +  + NY +SGS D  +R+W+++
Sbjct: 377 NPVNENYFMSGSIDGKVRIWNIS 399



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%)
 Frame = +2

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           + I +K LY   GH+  + D+  S D NY LS S DKT+RLW + +
Sbjct: 314 FRIMEKPLYEFRGHTGEVLDISWSKD-NYLLSASMDKTVRLWKVGS 358


>At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6
           WD-40 repeats (PF00400); similiar to rab11 binding
           protein (GI:4512103) [Bos taurus]
          Length = 903

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 1/84 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+GH   +  ++ +     ++LSSS DKT+ +W +   E    +   +L+ H+ +++ +
Sbjct: 501 SLKGHLDAILDLSWSKS--QLLLSSSMDKTVRLWDI---ETKTCL---KLFAHNDYVTCI 552

Query: 248 VLSS-DGNYALSGSWDKTLRLWDL 316
             S  D NY LSGS D  +R+W +
Sbjct: 553 QFSPVDENYFLSGSLDAKIRIWSI 576



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 17/38 (44%), Positives = 20/38 (52%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           P   L GH   I D+  S      LS S DKT+RLWD+
Sbjct: 498 PVCSLKGHLDAILDLSWSKS-QLLLSSSMDKTVRLWDI 534


>At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1
            protein (SCD1) contains Pfam PF02141: DENN (AEX-3)
            domain; contains Pfam PF00400: WD domain, G-beta repeat
            (8 copies); identical to stomatal cytokinesis defective
            [Arabidopsis thaliana] GI:19743728; supporting cDNA
            gi|19743727|gb|AY082605.1|; PMID 12874123
          Length = 1187

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 29/87 (33%), Positives = 49/87 (56%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +LR TL+GH G V  I+++      I+S S D ++IVW    D+    + ++ L GH   
Sbjct: 890  ELRATLKGHTGTVRAISSD---RGKIVSGSDDLSVIVW----DKQTTQLLEE-LKGHDSQ 941

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDL 316
            +S V + S G   L+ + D T+++WD+
Sbjct: 942  VSCVKMLS-GERVLTAAHDGTVKMWDV 967



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 25/104 (24%), Positives = 48/104 (46%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T +L   L+GH+  V+ +       + +L+++ D T+ +W +  D     + +      
Sbjct: 927  QTTQLLEELKGHDSQVSCVKMLSG--ERVLTAAHDGTVKMWDVRTDMCVATVGRCS---- 980

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S  +S     S G  A +G  D    +WD+ +GK   + + HTK
Sbjct: 981  SAILSLEYDDSTGILAAAGR-DTVANIWDIRSGKQMHKLKGHTK 1023


>At5g64630.2 68418.m08122 transducin family protein / WD-40 repeat
           family protein Similar to (SP:Q13112) Chromatin assembly
           factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo
           sapiens]
          Length = 487

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 1/106 (0%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKR 214
           K   ++  + +L  H   V  I  +P   +++ S +    L +WKL   E N      K 
Sbjct: 49  KKVPSVSYQSSLTYHGCAVNTIRFSPS-GELLASGADGGELFIWKLHPSETNQSWKVHKS 107

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L  H   + D+  S D  Y +SGS D +  +WD+  G   +  + H
Sbjct: 108 LSFHRKDVLDLQWSPDDAYLISGSVDNSCIIWDVNKGSVHQILDAH 153



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 23/92 (25%), Positives = 42/92 (45%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           S+ +++ K+  +L  H   V  +  +P     ++S S D + I+W +     N G   + 
Sbjct: 96  SETNQSWKVHKSLSFHRKDVLDLQWSPD-DAYLISGSVDNSCIIWDV-----NKGSVHQI 149

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L  H H++  V       Y  S S D+T R++
Sbjct: 150 LDAHCHYVQGVAWDPLAKYVASLSSDRTCRIY 181


>At5g64630.1 68418.m08121 transducin family protein / WD-40 repeat
           family protein Similar to (SP:Q13112) Chromatin assembly
           factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo
           sapiens]
          Length = 397

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 1/106 (0%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKR 214
           K   ++  + +L  H   V  I  +P   +++ S +    L +WKL   E N      K 
Sbjct: 49  KKVPSVSYQSSLTYHGCAVNTIRFSPS-GELLASGADGGELFIWKLHPSETNQSWKVHKS 107

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L  H   + D+  S D  Y +SGS D +  +WD+  G   +  + H
Sbjct: 108 LSFHRKDVLDLQWSPDDAYLISGSVDNSCIIWDVNKGSVHQILDAH 153



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 23/92 (25%), Positives = 42/92 (45%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           S+ +++ K+  +L  H   V  +  +P     ++S S D + I+W +     N G   + 
Sbjct: 96  SETNQSWKVHKSLSFHRKDVLDLQWSPD-DAYLISGSVDNSCIIWDV-----NKGSVHQI 149

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L  H H++  V       Y  S S D+T R++
Sbjct: 150 LDAHCHYVQGVAWDPLAKYVASLSSDRTCRIY 181


>At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to TIPD PROTEIN (SP:O15736)[Dictyostelium
           discoideum]
          Length = 515

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 28/100 (28%), Positives = 46/100 (46%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           ++R TL GH   V  +  +      ++S++ D+T+ +W L +     G     +   S+ 
Sbjct: 306 RVRHTLTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLHK-----GYCTNTVLFTSN- 359

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            + + LS DG    SG  D  LRLWD+  GK       H+
Sbjct: 360 CNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHS 399



 Score = 34.3 bits (75), Expect = 0.067
 Identities = 17/75 (22%), Positives = 35/75 (46%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +  +D+ + +W     + N G   K LYG    I D+ ++ D    ++ +    L +W
Sbjct: 246 LFTGGQDRAVKMW-----DTNSGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVW 300

Query: 311 DLAAGKTTRRFEDHT 355
           D+++G+       HT
Sbjct: 301 DVSSGRVRHTLTGHT 315


>At2g46290.1 68415.m05758 eukaryotic translation initiation factor 3
           subunit 2, putative / eIF-3 beta, putative / eIF3i,
           putative strong similarity to SP|Q38884 Eukaryotic
           translation initiation factor 3 subunit 2 (eIF-3 beta)
           (eIF3 p36) (eIF3i) (TGF-beta receptor interacting
           protein 1) (TRIP-1) {Arabidopsis thaliana}; contains
           Pfam PF00400: WD domain, G-beta repeat (5
           copies)|19799885|gb|AU231175.1|AU231175
          Length = 355

 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 27/92 (29%), Positives = 48/92 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   +T +  N +  D++ S ++D T  VW     +N   +   R  GHS  +    
Sbjct: 33  MKGHERPLTFLRYN-RNGDLLFSCAKDHTPTVWFA---DNGERLGTYR--GHSGAVWCCD 86

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +S D +  ++GS D+T +LWD+ +GK    F+
Sbjct: 87  ISRDSSRLITGSADQTAKLWDVKSGKELFTFK 118



 Score = 34.7 bits (76), Expect = 0.051
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH   I+ +  ++D ++ L+GS DKT +LWD+
Sbjct: 218 GHKEAITSLCKAADDSHFLTGSHDKTAKLWDM 249


>At5g50120.1 68418.m06207 transducin family protein / WD-40 repeat
           family protein Similar to En/Spm-like transposon protein
           (gi:2739374)[Arabidopsis thaliana]; similar to
           GTP-binding regulatory protein and WD-repeat protein;
           contains 7 WD-40 repeats
          Length = 388

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 25/84 (29%), Positives = 42/84 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L  HN  +  +A +     ++ S   D +++VW+  RD+    +    L GH+  +  + 
Sbjct: 255 LSEHNSGINALALSGTNGSLLHSGGSDGSILVWE--RDDGGDIVVVGMLRGHTESVLCLA 312

Query: 251 LSSDGNYALSGSWDKTLRLWDLAA 322
           + SD     SGS DKT+RLW  +A
Sbjct: 313 VVSD--ILCSGSADKTVRLWKCSA 334



 Score = 33.9 bits (74), Expect = 0.089
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           H   +S + LS DG    S SWD+TL++W
Sbjct: 164 HVDAVSGLALSRDGTLLYSVSWDRTLKIW 192


>At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat
           family protein contains 6 (4 significant) WD-40 repeats
           (PF0400); nuclear protein HIRA, mouse, PIR:S68141
          Length = 1051

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 29/102 (28%), Positives = 43/102 (42%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K   TLRGH   V  +  +P    M+ S S D T+ +W +       G+    L GH
Sbjct: 106 ENWKAVMTLRGHTADVVDLNWSPD-DSMLASGSLDNTVHIWNMRT-----GMCTTVLRGH 159

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +  V     G++  S S DKT+ +W  +      R + H
Sbjct: 160 LSLVKGVTWDPIGSFIASQSDDKTVIIWRTSDWGMAHRTDGH 201


>At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha,
           putative contains Pfam PF00400: WD domain, G-beta
           repeat; similar to Coatomer alpha subunit (Alpha-coat
           protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621)
           [Homo sapiens]
          Length = 1218

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 24/87 (27%), Positives = 45/87 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++  +  + + P  I+S+S D+T+ +W   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTVQFHHENP-WIVSASDDQTIRIWNW-QSRTCISV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
                 +  +S S D+T+R+WD+ A K
Sbjct: 142 SFHPKEDLVVSASLDQTVRVWDIGALK 168



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 22/81 (27%), Positives = 43/81 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V   + +P  P +I+S + D+ + +W++   +         L GH + +S V+
Sbjct: 200 LEGHDRGVNWASFHPTLP-LIVSGADDRQVKLWRMNETK---AWEVDTLRGHMNNVSSVM 255

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
             +  +  +S S DK++R+WD
Sbjct: 256 FHAKQDIIVSNSEDKSIRVWD 276



 Score = 34.3 bits (75), Expect = 0.067
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GHN +V   + +PK  D+++S+S D+T+ VW +   +     P   L   S   SD+ 
Sbjct: 131 LTGHNHYVMCASFHPK-EDLVVSASLDQTVRVWDIGALKKKSASPADDLMRFSQMNSDLF 189

Query: 251 LSSDG--NYALSG 283
              D    Y L G
Sbjct: 190 GGVDAIVKYVLEG 202



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +2

Query: 38  KMSETLKLR-GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +M+ET      TLRGH   V+ +  + K  D+I+S+S DK++ VW  T+
Sbjct: 232 RMNETKAWEVDTLRGHMNNVSSVMFHAKQ-DIIVSNSEDKSIRVWDATK 279


>At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1
           protein (ZFWD1) identical to zfwd1 protein (GI:12057164)
           [Arabidopsis thaliana]
          Length = 430

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           NG V Q+ +     D++ + ++D +++VW+     + +  P   L GH+  ++ V L   
Sbjct: 220 NGPVGQVYSLVVGTDLLFAGTQDGSILVWRYNSTTSCFD-PAASLLGHT--LAVVSLYVG 276

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            N   SG+ D ++++W L   +  +   +HT V
Sbjct: 277 ANRLYSGAMDNSIKVWSLDNLQCIQTLTEHTSV 309



 Score = 35.1 bits (77), Expect = 0.038
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           +L GH   ++ + L S  +   + S D+T+R+WD A+G+ T
Sbjct: 139 QLDGHQKVVTGIALPSGSDKLYTASKDETVRIWDCASGQCT 179


>At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat
           family protein similar to Transcriptional repressor
           rco-1 (SP:P78706) [Neurospora crassa]; similar to
           TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400)
          Length = 648

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 3/47 (6%)
 Frame = +2

Query: 182 DENNYGIP---QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +EN Y IP   + +L GH+  +S + + S G   LSGS+D T+R++D
Sbjct: 159 EENRYQIPLSNEIQLKGHTKIVSSLAVDSAGARVLSGSYDYTVRMYD 205



 Score = 33.9 bits (74), Expect = 0.089
 Identities = 15/31 (48%), Positives = 21/31 (67%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H+  I+ V  SSDG   LS S+D +L++WDL
Sbjct: 372 HTDDITSVKFSSDGRILLSRSFDGSLKVWDL 402



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 19/89 (21%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVV 250
           +GH   +T    +P+  + +L+SS D +L +W +    +   + + +L       ++   
Sbjct: 275 KGHICGLTCGEWHPRTKETVLTSSEDGSLRIWDVNNFLSQTQVIKPKLARPGRVPVTTCA 334

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
              DG     G  D ++++W L  G  +R
Sbjct: 335 WDRDGKRIAGGVGDGSIQIWSLKPGWGSR 363


>At5g64630.3 68418.m08123 transducin family protein / WD-40 repeat
           family protein Similar to (SP:Q13112) Chromatin assembly
           factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo
           sapiens]
          Length = 428

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           +++ S +    L +WKL   E N      K L  H   + D+  S D  Y +SGS D + 
Sbjct: 18  ELLASGADGGELFIWKLHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSC 77

Query: 302 RLWDLAAGKTTRRFEDH 352
            +WD+  G   +  + H
Sbjct: 78  IIWDVNKGSVHQILDAH 94



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 23/92 (25%), Positives = 42/92 (45%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           S+ +++ K+  +L  H   V  +  +P     ++S S D + I+W +     N G   + 
Sbjct: 37  SETNQSWKVHKSLSFHRKDVLDLQWSPD-DAYLISGSVDNSCIIWDV-----NKGSVHQI 90

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L  H H++  V       Y  S S D+T R++
Sbjct: 91  LDAHCHYVQGVAWDPLAKYVASLSSDRTCRIY 122


>At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5
           WD-40 repeats (PF00400); similar to pre-mRNA splicing
           factor PRP17 (SP:O60508) [Homo sapiens]
          Length = 457

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 25/94 (26%), Positives = 44/94 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   VT I  +  +  ++ S+  D  + VW +  ++       +    H+  + DV
Sbjct: 155 SLTGHTKAVTAIDWSTSHVHLLASAGLDGAVYVWNVWSNDKK---KVRAFLHHNAPVKDV 211

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             S  G   LS  +D T RL+D+  G  T+ F++
Sbjct: 212 KWSKQGLSLLSCGYDCTSRLFDVERGVETQSFKE 245


>At1g71840.1 68414.m08302 transducin family protein / WD-40 repeat
           family protein contains Pfam profile:PF00560 Leucine
           Rich Repeat (4 copies); Pfam profile:PF00069 Eukaryotic
           protein kinase domain; Pfam profile:PF00400 WD domain,
           G-beta repeat (7 copies)
          Length = 407

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 21/86 (24%), Positives = 39/86 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH G +  +A +P    ++ +   D    +WK+   +    +P     GH   +S +
Sbjct: 65  TFTGHKGELYALACSPTDATLVATGGGDDKAFLWKIGNGDWAAELP-----GHKDSVSCL 119

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
             S DG    SG  D  ++++D ++G
Sbjct: 120 AFSYDGQLLASGGLDGVVQIFDASSG 145



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 27/93 (29%), Positives = 47/93 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GHN  VT     P    +I + S D +LIVW     E+ + I +   Y H+  ++ + ++
Sbjct: 195 GHNLNVTCGDFTPD-GKLICTGSDDASLIVWNPKTCESIH-IVKGHPY-HTEGLTCLDIN 251

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S+ + A+SGS D ++ + ++  GK       HT
Sbjct: 252 SNSSLAISGSKDGSVHIVNIVTGKVVSSLNSHT 284


>At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4
           protein (ZFWD4) contains 6 WD-40 repeats (PF00400);
           contains Zinc finger C-x8-C-x5-C-x3-H type domain
           (PF00642); identical to zfwd4 protein (GI:12057170)
           [Arabidopsis thaliana]
          Length = 419

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           M+ + +   +++VWK T D  +        L GHS  ++   +   G    SGS DKT++
Sbjct: 224 MLFAGTSSGSILVWKATTDSESDPFKYLTSLEGHSGEVTCFAVG--GQMLYSGSVDKTIK 281

Query: 305 LWDLAAGKTTRRFEDHT 355
           +WDL   +     + HT
Sbjct: 282 MWDLNTLQCIMTLKQHT 298



 Score = 28.3 bits (60), Expect = 4.4
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           L GH+  +  + L    +   S S D TLR+WD  +G+
Sbjct: 127 LEGHNKELKGIALPEGSDKLFSVSIDGTLRVWDCNSGQ 164


>At4g04940.1 68417.m00718 transducin family protein / WD-40 repeat
           family protein contains seven G-protein beta WD-40
           repeats
          Length = 910

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           GH+  I+D+  S DG + +S S D +LR+WD+   K
Sbjct: 555 GHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAK 590



 Score = 25.8 bits (54), Expect(2) = 1.3
 Identities = 10/40 (25%), Positives = 18/40 (45%)
 Frame = +2

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           + + +KR Y H   +  V   S     +S  +   L++WD
Sbjct: 463 FDMSEKRRYAHDGEVIGVACDSTNTLMISAGYHGDLKVWD 502



 Score = 22.6 bits (46), Expect(2) = 1.3
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +2

Query: 290 DKTLRLWDLAAGKTTRRFEDHT 355
           D  +RL+D+   K  R F  HT
Sbjct: 536 DFVIRLYDVVTLKMVREFRGHT 557


>At5g67320.1 68418.m08490 WD-40 repeat family protein strong
           similarity to unknown protein (ref|NP_005638.1)
          Length = 613

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 21/78 (26%), Positives = 35/78 (44%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           NP     + S+S D T+ +W     +   G       GH   +  +  S +G Y  SGS 
Sbjct: 507 NPNKQLTLASASFDSTVKLW-----DAELGKMLCSFNGHREPVYSLAFSPNGEYIASGSL 561

Query: 290 DKTLRLWDLAAGKTTRRF 343
           DK++ +W +  GK  + +
Sbjct: 562 DKSIHIWSIKEGKIVKTY 579



 Score = 33.1 bits (72), Expect = 0.16
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   I  +  +  G+Y L+GS D+T  +WD+ A +  ++FE H+
Sbjct: 364 HKGPIFSLKWNKKGDYLLTGSVDRTAVVWDVKAEEWKQQFEFHS 407



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 26/99 (26%), Positives = 46/99 (46%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL  H G +  +  N K  D +L+ S D+T +VW +  +E      +++   HS  
Sbjct: 356 ELISTLSKHKGPIFSLKWNKK-GDYLLTGSVDRTAVVWDVKAEE-----WKQQFEFHSGP 409

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             DV   ++ ++A S S D  + L  +   +  + F  H
Sbjct: 410 TLDVDWRNNVSFATS-STDSMIYLCKIGETRPAKTFTGH 447



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 14/52 (26%), Positives = 22/52 (42%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           P K   GH   ++ V     G+   S S D T ++W++          +HTK
Sbjct: 440 PAKTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKIWNIKQSTFVHDLREHTK 491


>At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 883

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 1/116 (0%)
 Frame = +2

Query: 17  SLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY 196
           ++F P S    + K   + +GH   V  +A +      +LSSS DKT+ +W L+      
Sbjct: 491 NIFVPDSLFGLSEKPFCSFQGHVDDVLDLAWSKS--QHLLSSSMDKTVRLWNLSSQTC-- 546

Query: 197 GIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
                +++ HS +++ +  +  D  Y +SGS D  +R+W +   +    ++ H  V
Sbjct: 547 ----LKVFSHSDYVTCIQFNPVDDRYFISGSLDAKVRVWSIPDRQVVDWYDLHEMV 598



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +2

Query: 152 KTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV--LSSDGNYALSGSWDKTLRLWDLAA 322
           K+L +  +   ++ +G+ +K        + DV+    S   + LS S DKT+RLW+L++
Sbjct: 485 KSLSLENIFVPDSLFGLSEKPFCSFQGHVDDVLDLAWSKSQHLLSSSMDKTVRLWNLSS 543


>At1g15850.1 68414.m01902 transducin family protein / WD-40 repeat
           family protein contains 3 WD-40 repeats (PF00400);
           mRNA-associated protein mrnp 41 (SP:P78406) [Homo
           sapiens]; similar to mitotic checkpoint protein
           GI:9294423 from [Arabidopsis thaliana]
          Length = 140

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 18/78 (23%), Positives = 38/78 (48%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           ++ ++ +PK  D+++++S D  +  W++TR + +     K    H   +       DG  
Sbjct: 29  ISSLSFSPK-ADILVATSWDCQVRCWEITRSDGSIASEPKVSMSHDQPVLCSAWKDDGTT 87

Query: 272 ALSGSWDKTLRLWDLAAG 325
             +G  DK  ++W L +G
Sbjct: 88  VFTGGCDKQAKMWPLLSG 105


>At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 825

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           +LSSS DKT+ +W L+           +++ HS +++ +  +  D NY +SGS D  +R+
Sbjct: 482 LLSSSMDKTVRLWDLSSKTC------LKVFSHSDYVTCIQFNPVDDNYFISGSLDAKVRI 535

Query: 308 WDL 316
           W +
Sbjct: 536 WSI 538



 Score = 34.3 bits (75), Expect = 0.067
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 2/93 (2%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV-LS- 256
           NG    ++ +PK      S SR K++ +  +   E  +G+ +K +      + DV+ LS 
Sbjct: 419 NGSPEPVSMSPKRRGRT-SFSR-KSVSLDNVLVPEAVFGLSEKPVCSFVGHLDDVLDLSW 476

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S   + LS S DKT+RLWDL++ KT  +   H+
Sbjct: 477 SKSQHLLSSSMDKTVRLWDLSS-KTCLKVFSHS 508


>At4g35050.1 68417.m04974 WD-40 repeat protein (MSI3) contains 5
           WD-40 repeats (PF0400); identical to WD-40 repeat
           protein MSI3 (SP:O22469) [Arabidopsis thaliana]
          Length = 424

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 12/95 (12%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR--DE------NNYGIPQKRLY-- 220
           L  H G V Q+  +P +  ++ SS  D+ L+VW + R  DE      +    P + L+  
Sbjct: 301 LSKHEGEVFQVEWDPNHETVLASSGEDRRLMVWDINRVGDEQLEIELDAEDGPPELLFSH 360

Query: 221 -GHSHFISDVVLSSDGNYALSG-SWDKTLRLWDLA 319
            GH   ISD   + D  + +S  + D +L++W +A
Sbjct: 361 GGHKAKISDFAWNKDEPWVISSVAEDNSLQVWQMA 395



 Score = 31.1 bits (67), Expect = 0.63
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRLWDLAAGKTTR 337
           P  RL GH      +  SS    Y LSGS D+ + LWD++A  T +
Sbjct: 161 PDLRLMGHEQEGYGLAWSSFKEGYLLSGSQDQRICLWDVSATATDK 206


>At4g18900.1 68417.m02786 transducin family protein / WD-40 repeat
           family protein contains 5 (4 significant) WD-40 repeats;
           similar to periodic tryptophan protein 1 homolog  
           (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610)
           (PIR2:I39360) [Homo sapiens]
          Length = 461

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+   T ++ N   P+++ + S+D+T+ +W L+ +E +         G   FI+  
Sbjct: 364 TINGHDEAATSVSYNISAPNLLATGSKDRTVKLWDLSNNEPSCIATHNPNAGGLFFIA-- 421

Query: 248 VLSSDGNYALS-GSWDKTLRLWD 313
             S D  + L+ G     L+LWD
Sbjct: 422 -FSPDNPFLLAMGGVMGELKLWD 443



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           N   S S DK +++WD+A G      E HTK
Sbjct: 247 NILASASADKKVKVWDVATGTCKITMEHHTK 277



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRLWDLA 319
           P   + GH    + V  + S  N   +GS D+T++LWDL+
Sbjct: 361 PSFTINGHDEAATSVSYNISAPNLLATGSKDRTVKLWDLS 400


>At2g46280.3 68415.m05757 eukaryotic translation initiation factor 3
           subunit 2 / TGF-beta receptor interacting protein 1 /
           eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to
           eukaryotic translation initiation factor 3 subunit 2
           (SP:Q38884) {Arabidopsis thaliana}; contains Pfam
           PF00400: WD domain, G-beta repeat (5 copies)
          Length = 254

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 25/92 (27%), Positives = 48/92 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   +T +  N +  D++ S ++D T  +W     +N   +   R  GH+  +    
Sbjct: 6   MKGHERPLTFLRYN-REGDLLFSCAKDHTPTLWFA---DNGERLGTYR--GHNGAVWCCD 59

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +S D +  ++GS D+T +LWD+ +GK    F+
Sbjct: 60  VSRDSSRLITGSADQTAKLWDVKSGKELFTFK 91



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           I+S   DK + +W     E    + Q     GH   I+ +  ++D ++ L+GS DKT +L
Sbjct: 163 IVSGGEDKVIRIWDA---ETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKL 219

Query: 308 WDL 316
           WD+
Sbjct: 220 WDM 222


>At2g46280.2 68415.m05756 eukaryotic translation initiation factor 3
           subunit 2 / TGF-beta receptor interacting protein 1 /
           eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to
           eukaryotic translation initiation factor 3 subunit 2
           (SP:Q38884) {Arabidopsis thaliana}; contains Pfam
           PF00400: WD domain, G-beta repeat (5 copies)
          Length = 328

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 25/92 (27%), Positives = 48/92 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   +T +  N +  D++ S ++D T  +W     +N   +   R  GH+  +    
Sbjct: 6   MKGHERPLTFLRYN-REGDLLFSCAKDHTPTLWFA---DNGERLGTYR--GHNGAVWCCD 59

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +S D +  ++GS D+T +LWD+ +GK    F+
Sbjct: 60  VSRDSSRLITGSADQTAKLWDVKSGKELFTFK 91



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           I+S   DK + +W     E    + Q     GH   I+ +  ++D ++ L+GS DKT +L
Sbjct: 163 IVSGGEDKVIRIWDA---ETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKL 219

Query: 308 WDL 316
           WD+
Sbjct: 220 WDM 222


>At2g46280.1 68415.m05755 eukaryotic translation initiation factor 3
           subunit 2 / TGF-beta receptor interacting protein 1 /
           eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to
           eukaryotic translation initiation factor 3 subunit 2
           (SP:Q38884) {Arabidopsis thaliana}; contains Pfam
           PF00400: WD domain, G-beta repeat (5 copies)
          Length = 328

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 25/92 (27%), Positives = 48/92 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   +T +  N +  D++ S ++D T  +W     +N   +   R  GH+  +    
Sbjct: 6   MKGHERPLTFLRYN-REGDLLFSCAKDHTPTLWFA---DNGERLGTYR--GHNGAVWCCD 59

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +S D +  ++GS D+T +LWD+ +GK    F+
Sbjct: 60  VSRDSSRLITGSADQTAKLWDVKSGKELFTFK 91



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           I+S   DK + +W     E    + Q     GH   I+ +  ++D ++ L+GS DKT +L
Sbjct: 163 IVSGGEDKVIRIWDA---ETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKL 219

Query: 308 WDL 316
           WD+
Sbjct: 220 WDM 222


>At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat
           family protein similar to WD-repeat protein 9
           (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD
           domain, G-beta repeat (4 copies)
          Length = 1677

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 30/110 (27%), Positives = 50/110 (45%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP S + +   ++  LRGH   V   A   +    +++ S D+ + VW +   +  Y + 
Sbjct: 227 KPSSMVQKMQNIK-RLRGHRNAV-YCAILDRSGRYVITGSDDRLVKVWSM---DTAYCLA 281

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             R  GH   I+D+ +SS+  +  S S D  +R+W L  G        HT
Sbjct: 282 SCR--GHEGDITDLAVSSNNIFIASASNDCVIRVWRLPDGLPVSVLRGHT 329



 Score = 33.9 bits (74), Expect = 0.089
 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVW 169
           LRGH G VT IA +P+   P  +LSSS D T  +W
Sbjct: 325 LRGHTGAVTAIAFSPRPGSPYQLLSSSDDGTCRIW 359


>At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4
           significant) WD-40 repeats (PF0400); identical to WD-40
           repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana]
          Length = 507

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 27/90 (30%), Positives = 36/90 (40%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S T+  RG   GH   V  +A +P       S   D  LI+W      N     +K    
Sbjct: 279 SPTVGPRGVYHGHEDTVEDVAFSPTSAQEFCSVGDDSCLILWDARTGTNPVTKVEKAHDA 338

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
             H +       D N  L+GS D T+RL+D
Sbjct: 339 DLHCVD--WNPHDDNLILTGSADNTVRLFD 366



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 20/93 (21%), Positives = 38/93 (40%), Gaps = 8/93 (8%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI-------PQKRLYGHSHFI 238
           H G V +I   P+   ++ + +    +++W +    N + +       P   L GH    
Sbjct: 163 HPGEVNRIRELPQNSKIVATHTDSPDVLIWDVETQPNRHAVLGAANSRPDLILTGHQDNA 222

Query: 239 S-DVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
              + +     + LSG  DK++ LW +    TT
Sbjct: 223 EFALAMCPTEPFVLSGGKDKSVVLWSIQDHITT 255


>At1g49450.1 68414.m05543 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to En/Spm-like transposon protein GI:2739374
           from [Arabidopsis thaliana]; no characterized homologs
          Length = 471

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H   +S + L+ D     SGSWDKTL++W L+  K     E H
Sbjct: 244 HFDAVSCLSLNEDLGLLYSGSWDKTLKVWRLSDSKCLESIEAH 286



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S S DKTL VW+L+  +       + +  H   ++ VV   D +   +GS D TL++
Sbjct: 259 LLYSGSWDKTLKVWRLSDSK-----CLESIEAHDDAVNTVVSGFD-DLVFTGSADGTLKV 312

Query: 308 W 310
           W
Sbjct: 313 W 313


>At1g24530.1 68414.m03088 transducin family protein / WD-40 repeat
           family protein similar to Vegetatible incompatibility
           protein HET-E-1 (SP:Q00808) {Podospora anserina};
           contains 7 WD-40 repeats (PF00400)
          Length = 418

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 20/87 (22%), Positives = 43/87 (49%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L+ + +++ H+  V  IA +      + + S D+ + VW     E  + +    L  H  
Sbjct: 225 LRCKESIKAHDDAVNAIAVSTN--GTVYTGSADRRIRVWAKPTGEKRHTLVAT-LEKHKS 281

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWD 313
            ++ + L+ DG+   SGS D+++ +W+
Sbjct: 282 AVNALALNDDGSVLFSGSCDRSILVWE 308



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 27/105 (25%), Positives = 49/105 (46%), Gaps = 5/105 (4%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S  + +RG LRGH+  +  +       D++LS S D+T+ +W+   D ++Y   +  L G
Sbjct: 313 SNYMAVRGALRGHDKAILSLFN---VSDLLLSGSADRTVRIWRRGPD-SSYSCLEV-LSG 367

Query: 224 HSHFISDVVL-----SSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           H+  +  +         D    +SGS D  ++ W ++  K    F
Sbjct: 368 HTKPVKSLAAVREKELDDVVSIISGSLDGEVKCWKVSVTKPDNSF 412



 Score = 28.7 bits (61), Expect = 3.3
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 4/52 (7%)
 Frame = +2

Query: 206 QKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLW---DLAAGKTTRRFED 349
           +KRL+  H+  ++ + +S DG +  S SWDKTL++W   DL   ++ +  +D
Sbjct: 187 KKRLWIEHADAVTALAVS-DG-FIYSVSWDKTLKIWRASDLRCKESIKAHDD 236


>At1g24130.1 68414.m03044 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats
           (PF00400);similar to beta transducin-like protein
           HET-D2Y (GI:17225210) [Podospora anserina].
          Length = 415

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 8/92 (8%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G LRGH   +  +A      D++LS S DK+L VW+    E         L GH+  +  
Sbjct: 322 GALRGHRKAIMCLAVAS---DLVLSGSADKSLRVWRRGLMEKEGYSCLAVLEGHTKPVKS 378

Query: 245 VVLS---SDGN-----YALSGSWDKTLRLWDL 316
           + +S   SD N        SGS D +L++W+L
Sbjct: 379 LAVSVSDSDSNSDYSCMVYSGSLDLSLKVWNL 410



 Score = 33.1 bits (72), Expect = 0.16
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           H   +S + LS DG+   S SWD++ ++W
Sbjct: 191 HVDAVSSLALSQDGSLLYSASWDRSFKIW 219



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 15/61 (24%), Positives = 32/61 (52%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + S DK + VW   +D+ +  +    L  H   ++ + +S DG    SG+ D+++ +W
Sbjct: 249 VYTGSADKKIKVWN-KKDKKHSLVAT--LTKHLSAVNALAISEDGKVLYSGACDRSILVW 305

Query: 311 D 313
           +
Sbjct: 306 E 306


>At5g56130.1 68418.m07002 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           similar to beta transducin-like protein HET-E2C*4
           (GI:17225206) [Podospora anserina]
          Length = 315

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 1/92 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +A N      + S S D+T  +W +     +       L GH+  +  +  
Sbjct: 17  QGHKKKVHSVAWNSN-GTKLASGSVDQTARIWNI-EPHGHSKAKDLELKGHTDSVDQLCW 74

Query: 254 S-SDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
                +   + S DK++RLWD  +GK T++ E
Sbjct: 75  DPKHSDLVATASGDKSVRLWDARSGKCTQQVE 106



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 23/90 (25%), Positives = 42/90 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   V Q+  +PK+ D++ ++S DK++ +W      +     Q  L G +    ++ 
Sbjct: 62  LKGHTDSVDQLCWDPKHSDLVATASGDKSVRLWDA---RSGKCTQQVELSGEN---INIT 115

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
              DG +   G+ D  L + D+   K   R
Sbjct: 116 YKPDGTHVAVGNRDDELTILDVRKFKPLHR 145


>At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6
           WD-40 repeats (PF00400); rab11 binding protein, Bos
           taurus, EMBL:AF117897
          Length = 905

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 1/65 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLR 304
           ++LSSS DKT+ +W +            +L+ H+ +++ V  +  D +Y +SGS D  +R
Sbjct: 532 LLLSSSMDKTVRLWDIETQSC------LKLFAHNDYVTCVQFNPLDEDYFISGSLDAKIR 585

Query: 305 LWDLA 319
           +W+++
Sbjct: 586 IWNIS 590



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 22/80 (27%), Positives = 35/80 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L  HN +VT +  NP   D  +S S D  + +W ++   N   +    L      ++ V 
Sbjct: 555 LFAHNDYVTCVQFNPLDEDYFISGSLDAKIRIWNIS---NRQVVEWNDL---KEMVTAVC 608

Query: 251 LSSDGNYALSGSWDKTLRLW 310
            + DG  A  GS +   RL+
Sbjct: 609 YTPDGQAAFVGSINGHCRLY 628



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVV-LS-SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           E  + +  K +   +  + DV+ LS S     LS S DKT+RLWD+      + F
Sbjct: 502 ETVFSLSDKPICSFTGHLDDVLDLSWSRSQLLLSSSMDKTVRLWDIETQSCLKLF 556


>At4g03020.1 68417.m00410 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           similar to L. erythrorhizon LEC14B, GenBank accession
           number Q40153
          Length = 493

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 23/79 (29%), Positives = 35/79 (44%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V  +    +  ++ILS S D    VW   R       P   L GH   ++ +    
Sbjct: 270 HTSDVNTVCFADESGNLILSGSDDNLCKVWD-RRCFIGRDKPAGVLVGHLEGVTFIDSRG 328

Query: 260 DGNYALSGSWDKTLRLWDL 316
           DG Y +S   D+T++LWD+
Sbjct: 329 DGRYFISNGKDQTIKLWDI 347



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           G+S  I  V  S+DG   ++GS D ++ ++DL A + + R   HT
Sbjct: 227 GYSFGIFSVKFSTDGREVVAGSSDDSIYVYDLEANRVSLRTVAHT 271


>At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to WD40-repeat containing protein Ciao 1
           (SP:O76071) [Homo sapiens]
          Length = 352

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ---KRLYGHSHFIS 241
           L GH   V  +  +P   D++ S S D T+ VW    D+  Y   Q   +   GHS  + 
Sbjct: 159 LTGHTQDVKMVQWHPTM-DVLFSCSYDNTIKVWWSEDDDGEYQCVQTLGESNNGHSSTVW 217

Query: 242 DVVLSSDGNYALSGSWDKTLRLW 310
            +  ++ G+  ++ S D TL++W
Sbjct: 218 SISFNAAGDKMVTCSDDLTLKIW 240



 Score = 28.3 bits (60), Expect = 4.4
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 3/85 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK---RLYGHSHFISDVV 250
           H   V   A +P    ++ ++S D T  +WK      NYG   +    L GH + +  V 
Sbjct: 73  HTRTVRSCAWSPS-GQLLATASFDGTTGIWK------NYGSEFECISTLEGHENEVKSVS 125

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAG 325
            ++ G+   + S DK++ +W++  G
Sbjct: 126 WNASGSCLATCSRDKSVWIWEVLEG 150


>At2g19430.1 68415.m02267 transducin family protein / WD-40 repeat
           family protein similar to WD-repeat protein 5
           (SP:Q9UGP9) [Homo sapiens]; contains 7 Trp-Asp WD-40
           repeats
          Length = 367

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           GHS ++  VV  S  +  L+GS D T R+WD   GK  +
Sbjct: 199 GHSDYLHTVVSRSSASQILTGSEDGTARIWDCKTGKCVK 237


>At3g49180.1 68416.m05375 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           GTP-binding protein beta chain homolog, Nicotiana
           tabacum, PIR:T16970
          Length = 438

 Score = 36.7 bits (81), Expect = 0.013
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 8/101 (7%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ-KRLYGH 226
           T KL     GH   VT +  +     +++S S+D ++ VW L R  +++   Q   LY H
Sbjct: 109 TGKLLKKWHGHYRSVTCLVFSGD-DSLLVSGSQDGSIRVWSLIRLFDDFQRQQGNTLYEH 167

Query: 227 S---HFIS--DVVLSSDGNYA--LSGSWDKTLRLWDLAAGK 328
           +   H +S  D+V+   G  A  +S S D+T ++W L+ GK
Sbjct: 168 NFNEHTMSVTDIVIDYGGCNAVIISSSEDRTCKVWSLSRGK 208



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I  +  +++G Y + G     + LW++A GK  +++  H
Sbjct: 81  IKALAANNEGTYLVGGGISGDIYLWEVATGKLLKKWHGH 119


>At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]; similar to rab11 binding protein GI:4512103
           from [Bos taurus]
          Length = 593

 Score = 36.7 bits (81), Expect = 0.013
 Identities = 18/36 (50%), Positives = 23/36 (63%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           P + LYGH+  + D+  S D N  LS S DKT+RLW
Sbjct: 264 PFQELYGHTGDVLDLAWS-DSNLLLSASKDKTVRLW 298



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 25/85 (29%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V  +A +    +++LS+S+DKT+ +W+   D+  +      ++ H+++++ V 
Sbjct: 268 LYGHTGDVLDLAWSDS--NLLLSASKDKTVRLWRTGCDQCLH------VFHHNNYVTCVE 319

Query: 251 LS--SDGNYALSGSWDKTLRLWDLA 319
            +  +  N+A SGS D   R+W L+
Sbjct: 320 FNPVNKNNFA-SGSIDGKARIWGLS 343


>At3g50390.1 68416.m05512 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to myosin heavy chain kinase B (gb:U90946)
           [Dictyostelium discoideum]
          Length = 469

 Score = 34.7 bits (76), Expect(2) = 0.016
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 3/47 (6%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLW---DLAAGKTTRRFED 349
           + H   IS + LS D     SGSWDKT ++W   DL   ++    ED
Sbjct: 208 FRHLDAISCLALSEDKRLLYSGSWDKTFKVWRVSDLRCVESVNAHED 254



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           VT IA +     ++   S D T+  W+   +  N G+    L GH   ++ + L + GN 
Sbjct: 303 VTAIAVDQS-ATLVYCGSSDGTVNFWERENNMKNGGV----LKGHK--LAVLCLVAAGNL 355

Query: 272 ALSGSWDKTLRLW 310
             SGS D  +R+W
Sbjct: 356 MFSGSADLGIRVW 368



 Score = 20.6 bits (41), Expect(2) = 0.016
 Identities = 8/23 (34%), Positives = 12/23 (52%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENN 193
           D I +  +D  + VWK    E+N
Sbjct: 147 DKIFTGHQDGKIRVWKAASKESN 169


>At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3
           protein (ZFWD3) contains 5 WD-40 repeats (PF00400);
           contains Zinc finger C-x8-C-x5-C-x3-H type domain
           (PF00642); identical to zfwd3 protein (GP:12057168)
           {Arabidopsis thaliana}
          Length = 472

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 23/77 (29%), Positives = 35/77 (45%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G V Q+        M+ + +   +++VWK T  E++       L GH H          G
Sbjct: 264 GVVGQVHAMTAANGMLFAGTSSGSILVWKATDSESDPFKYLTSLEGH-HSGEVTCFVVGG 322

Query: 266 NYALSGSWDKTLRLWDL 316
               SGS DKT+++WDL
Sbjct: 323 EVLYSGSVDKTIKVWDL 339



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           L GH + I  + L    +   S S D TL +WD  +G+  R
Sbjct: 183 LEGHKNDIKGIALPQGSDKLFSVSGDGTLLIWDCNSGQCVR 223


>At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis
           repressor; identical to COP1 regulatory protein/FUSCA
           protein FUS1 GI:402685 SP:P43254
          Length = 675

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 22/58 (37%), Positives = 25/58 (43%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           D  N   P     GH   +S V   S+   A S S D TLRLWD+      R F  HT
Sbjct: 534 DLRNISQPLHVFSGHKKAVSYVKFLSNNELA-SASTDSTLRLWDVKDNLPVRTFRGHT 590


>At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5
           WD-40 repeats (PF0400); identical to WD-40 repeat
           protein MSI2 (SP:O22468) [Arabidopsis thaliana] WD-40
           repeats (PF0400);
          Length = 415

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 12/95 (12%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR-DENNYGI-------PQKRLY-- 220
           +  H G V Q+  +P +  ++ SS  D+ L+VW L R  E    I       P + L+  
Sbjct: 300 MSSHEGEVFQVEWDPNHETVLASSGEDRRLMVWDLNRVGEEQLEIELDAEDGPPELLFSH 359

Query: 221 -GHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLA 319
            GH   ISD   + +  + + S + D +L++W +A
Sbjct: 360 GGHKAKISDFAWNKNEPWVIASVAEDNSLQVWQMA 394


>At1g80670.1 68414.m09466 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400) (1
           weak); similar to Hypothetical RAE1-like
           protein.(SP:Q38942) [Arabidopsis thaliana]; similar to
           mRNA-associated protein mrnp 41 ((mRNA export protein)
           (GB:AAC28126) (GI:1903456)(RAE1) (MRNP41) (SP:P78406)
           [Homo sapiens]
          Length = 349

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 17/78 (21%), Positives = 37/78 (47%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           ++ ++ +P+  D+++++S D  +  W+++R   +     K    H   +       DG  
Sbjct: 28  ISSLSFSPR-ADILVATSWDNQVRCWEISRSGASLASAPKASISHDQPVLCSAWKDDGTT 86

Query: 272 ALSGSWDKTLRLWDLAAG 325
             SG  DK  ++W L +G
Sbjct: 87  VFSGGCDKQAKMWPLLSG 104



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWD 313
           N   +GSWDKTL+ WD
Sbjct: 127 NLLATGSWDKTLKYWD 142


>At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat
           family protein Strong similarity to gb X95263 Periodic
           tryptophan protein 2 gene (PWP2) from Homo sapiens and
           contains 6 WD40, G-beta repeat domains
          Length = 860

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 25/107 (23%), Positives = 44/107 (41%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           +G    F+ F    +T +++  L GH   V  +  +P    ++ SSS D T+ +W +   
Sbjct: 451 AGTLDSFEIFVWSKKTGQIKDILSGHEAPVHGLMFSP-LTQLLASSSWDYTVRLWDVFAS 509

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +          + H+H +  V    DG    S + D  +  WD   G
Sbjct: 510 KGTV-----ETFRHNHDVLTVAFRPDGKQLASSTLDGQINFWDTIEG 551



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           L GH   +  ++ S       S SWD T+RLWD+ A K T
Sbjct: 473 LSGHEAPVHGLMFSPLTQLLASSSWDYTVRLWDVFASKGT 512



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GH   ++ V  S D     +G+ D  +++W++ +G     F +HT
Sbjct: 347 GHYFDVNCVTYSPDSQLLATGADDNKVKVWNVMSGTCFITFTEHT 391


>At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat
           family protein Strong similarity to gb X95263 Periodic
           tryptophan protein 2 gene (PWP2) from Homo sapiens and
           contains 6 WD40, G-beta repeat domains
          Length = 900

 Score = 36.3 bits (80), Expect = 0.017
 Identities = 25/107 (23%), Positives = 44/107 (41%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           +G    F+ F    +T +++  L GH   V  +  +P    ++ SSS D T+ +W +   
Sbjct: 491 AGTLDSFEIFVWSKKTGQIKDILSGHEAPVHGLMFSP-LTQLLASSSWDYTVRLWDVFAS 549

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +          + H+H +  V    DG    S + D  +  WD   G
Sbjct: 550 KGTV-----ETFRHNHDVLTVAFRPDGKQLASSTLDGQINFWDTIEG 591



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           L GH   +  ++ S       S SWD T+RLWD+ A K T
Sbjct: 513 LSGHEAPVHGLMFSPLTQLLASSSWDYTVRLWDVFASKGT 552



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GH   ++ V  S D     +G+ D  +++W++ +G     F +HT
Sbjct: 387 GHYFDVNCVTYSPDSQLLATGADDNKVKVWNVMSGTCFITFTEHT 431


>At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG)
           contains seven G-protein beta WD-40 repeats; beta
           transducin-like protein, Podospora anserina, gb:L28125;
           contains Pfam profiles PF04503:  Single-stranded DNA
           binding protein, SSDP; PF00400:WD domain, G-beta repeat;
           identical to cDNA LEUNIG (LEUNIG) GI:11141604
          Length = 931

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           M+ S+  DK  ++W     +     P+  L  H+  I+D+  S       + S+DKT+R+
Sbjct: 665 MLASAGHDKKAVLWYTDTMK-----PKTTLEEHTAMITDIRFSPSQLRLATSSFDKTVRV 719

Query: 308 WDL-AAGKTTRRFEDHTKV 361
           WD    G + R F  H+ +
Sbjct: 720 WDADNKGYSLRTFMGHSSM 738


>At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat
           family protein contains seven WD-40 G-protein beta
           repeats; similar to RA-regulated nuclear
           matrix-associated protein (GI:14161320) {Homo sapiens}
          Length = 535

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           E  K  G L GH G V  + ++P   D+++S SRD    +W L
Sbjct: 158 EENKCTGVLIGHTGTVKSMCSHPTNSDLLVSGSRDGCFALWDL 200



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 16/60 (26%), Positives = 26/60 (43%)
 Frame = +2

Query: 176 TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           T  EN      +    H + I D+      +  L+ S D+T+++WD+   K T     HT
Sbjct: 111 THQENTEKARFRDWIAHYNAIFDISWIKGDSCLLTASGDQTIKVWDVEENKCTGVLIGHT 170



 Score = 28.7 bits (61), Expect = 3.3
 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
           +L++S D+T+ VW +  ++   G+    L GH+  +  +    ++ +  +SGS D    L
Sbjct: 143 LLTASGDQTIKVWDVEENKCT-GV----LIGHTGTVKSMCSHPTNSDLLVSGSRDGCFAL 197

Query: 308 WDLAAGKTTRRFE 346
           WDL    ++ + E
Sbjct: 198 WDLRCKSSSHKEE 210


>At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7
           WD-40 repeats ; similar to LEUNIG
           (GP:11141605)[Arabidopsis thaliana]
          Length = 785

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+  DK + +W +   +     P++    H+H I+DV    +     + S+DKT+++
Sbjct: 522 LLASAGHDKKVFIWNMETLQVE-STPEE----HAHIITDVRFRPNSTQLATSSFDKTIKI 576

Query: 308 WD 313
           WD
Sbjct: 577 WD 578


>At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7
           WD-40 repeats ; similar to LEUNIG
           (GP:11141605)[Arabidopsis thaliana]
          Length = 787

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+  DK + +W +   +     P++    H+H I+DV    +     + S+DKT+++
Sbjct: 524 LLASAGHDKKVFIWNMETLQVE-STPEE----HAHIITDVRFRPNSTQLATSSFDKTIKI 578

Query: 308 WD 313
           WD
Sbjct: 579 WD 580


>At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7
           WD-40 repeats ; similar to LEUNIG
           (GP:11141605)[Arabidopsis thaliana]
          Length = 787

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+  DK + +W +   +     P++    H+H I+DV    +     + S+DKT+++
Sbjct: 524 LLASAGHDKKVFIWNMETLQVE-STPEE----HAHIITDVRFRPNSTQLATSSFDKTIKI 578

Query: 308 WD 313
           WD
Sbjct: 579 WD 580


>At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7
           WD-40 repeats ; similar to LEUNIG
           (GP:11141605)[Arabidopsis thaliana]
          Length = 787

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+  DK + +W +   +     P++    H+H I+DV    +     + S+DKT+++
Sbjct: 524 LLASAGHDKKVFIWNMETLQVE-STPEE----HAHIITDVRFRPNSTQLATSSFDKTIKI 578

Query: 308 WD 313
           WD
Sbjct: 579 WD 580


>At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7
           WD-40 repeats ; similar to LEUNIG
           (GP:11141605)[Arabidopsis thaliana]
          Length = 787

 Score = 35.9 bits (79), Expect = 0.022
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+  DK + +W +   +     P++    H+H I+DV    +     + S+DKT+++
Sbjct: 524 LLASAGHDKKVFIWNMETLQVE-STPEE----HAHIITDVRFRPNSTQLATSSFDKTIKI 578

Query: 308 WD 313
           WD
Sbjct: 579 WD 580


>At5g58230.1 68418.m07290 WD-40 repeat protein (MSI1) contains 6
           WD-40 repeats (PF0400); identical to WD-40 repeat
           protein (SP:O22467) [Arabidopsis thaliana]
          Length = 424

 Score = 35.5 bits (78), Expect = 0.029
 Identities = 24/105 (22%), Positives = 51/105 (48%), Gaps = 2/105 (1%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +++L  +   + H G V  +A + ++  +  S   D+ L++W L     +   P + +  
Sbjct: 214 NKSLDAQQIFKAHEGVVEDVAWHLRHEYLFGSVGDDQYLLIWDLRSPSASK--PVQSVVA 271

Query: 224 HSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGKTT-RRFEDH 352
           HS  ++ +  +    + + +GS DKT++L+DL    T    F+ H
Sbjct: 272 HSMEVNCLAFNPFNEWVVATGSTDKTVKLFDLRKLSTALHTFDSH 316



 Score = 33.9 bits (74), Expect = 0.089
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 10/94 (10%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI------PQKRLY--- 220
           T   H   V Q+  NPK   ++ S    + L+VW L+R +    +      P + L+   
Sbjct: 312 TFDSHKEEVFQVGWNPKNETILASCCLGRRLMVWDLSRIDEEQTVEDAEDGPPELLFIHG 371

Query: 221 GHSHFISDVVLSSDGNYALSG-SWDKTLRLWDLA 319
           GH+  ISD   +   ++ +S  + D  L++W +A
Sbjct: 372 GHTSKISDFSWNPCEDWVISSVAEDNILQIWQMA 405


>At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5
           WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595)
           {Xenopus laevis}; WD-repeat protein, carrot, PIR:T14352
          Length = 444

 Score = 35.5 bits (78), Expect = 0.029
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 6/51 (11%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWD--LAAGKTTR----RFEDHT 355
           GH+  +  +  S  GN   SG  D  + +WD  LA+ K TR    RFE+HT
Sbjct: 250 GHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASSKQTRQWLHRFEEHT 300


>At3g20740.1 68416.m02624 fertilization-independent endosperm
           protein (FIE) contains 6 WD-40 repeats (PF00400);
           identical to fertilization-independent endosperm protein
           (GI:4567095) [Arabidopsis thaliana]
          Length = 369

 Score = 35.5 bits (78), Expect = 0.029
 Identities = 16/58 (27%), Positives = 32/58 (55%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           A G   + +     SET+    +L GH   V +I T P  P +++++S+D+++ +W +
Sbjct: 103 AGGVKGIIRVIDVNSETI--HKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNV 158


>At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat
           family protein similar to Vegetatible incompatibility
           protein HET-E-1 (SP:Q00808) {Podospora anserina};
           contains 5 WD-40 repeats (PF00400); similar to  beta
           transducin-like protein HET-E2C*4
           (GP:17225206)[Podospora anserina]
          Length = 530

 Score = 35.1 bits (77), Expect = 0.038
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 2/98 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  +V     +P    M+++ S D T+ VW      +N+ I +     H   + DVV
Sbjct: 174 LLGHKDYVRCGDCSPVNDSMLVTGSYDHTVKVWDARVHTSNW-IAE---INHGLPVEDVV 229

Query: 251 -LSSDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDHTK 358
            L S G  A +G    ++++WDL   GK     E H K
Sbjct: 230 YLPSGGLIATAGG--NSVKVWDLIGGGKMVCSMESHNK 265


>At1g29260.1 68414.m03578 peroxisomal targeting signal type 2
           receptor (PEX7) identical to peroxisomal targeting
           signal type 2 receptor (Pex7p) (GI:9502414) [Arabidopsis
           thaliana]; WD-40 repeat protein family member; contains
           6 WD-40 repeats (PF00400); similar to peroxismal
           targeting signal 2 receptor (PTS2R) (Peroxin-7)
           (PEX7)(SP:O00628) [Homo sapiens]
          Length = 317

 Score = 35.1 bits (77), Expect = 0.038
 Identities = 24/83 (28%), Positives = 37/83 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T + H   V Q   NPK+ D+  S+S D TL +W +    +   IP          +S  
Sbjct: 144 TFKEHAYCVYQAVWNPKHGDVFASASGDCTLRIWDVREPGSTMIIPAHDF----EILSCD 199

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
               D     + S DKT+++WD+
Sbjct: 200 WNKYDDCILATSSVDKTVKVWDV 222



 Score = 33.9 bits (74), Expect = 0.089
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 1/92 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H   V  +  NP   D  L+SS D T+ +W + R  +      +    H++ +   V + 
Sbjct: 105 HAREVQSVDYNPTRRDSFLTSSWDDTVKLWAMDRPAS-----VRTFKEHAYCVYQAVWNP 159

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             G+   S S D TLR+WD+    +T     H
Sbjct: 160 KHGDVFASASGDCTLRIWDVREPGSTMIIPAH 191


>At1g03110.1 68414.m00288 transducin family protein / WD-40 repeat
           family protein contains 4 WD-40 repeats (PF00400);
           similar to WD-repeat domain 4 protein (GI:9955698) [Mus
           musculus]
          Length = 427

 Score = 35.1 bits (77), Expect = 0.038
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRD--ENNYGIPQKRLYGHSHFISDVVLSSDGN----YALSGSWD 292
           ILS+ RD  + V    +   E  + I Q    GHS FI+     S       Y +SGS D
Sbjct: 170 ILSADRDFKIRVTVFPKKPLEGAHEI-QSFCLGHSEFITCTAFVSTPELTQGYLMSGSGD 228

Query: 293 KTLRLWDLAAG 325
            T+RLWD+ +G
Sbjct: 229 STVRLWDITSG 239


>At3g18950.1 68416.m02405 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to En/Spm-like transposon protein GI:2739374
           from [Arabidopsis thaliana]; no characterized homologs
          Length = 473

 Score = 34.7 bits (76), Expect = 0.051
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H   +S + L+ +     SGSWDKTL++W L+  K     + H
Sbjct: 248 HYDAVSCLSLNEELGLLYSGSWDKTLKVWRLSDSKCLESIQAH 290



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S S DKTL VW+L+  +       + +  H   I+ V    D +   +GS D TL++
Sbjct: 263 LLYSGSWDKTLKVWRLSDSK-----CLESIQAHDDAINTVAAGFD-DLLFTGSADGTLKV 316

Query: 308 WDL-AAGKTTRRF 343
           W     GK T+ F
Sbjct: 317 WKRELQGKGTKHF 329


>At3g06880.1 68416.m00817 transducin family protein / WD-40 repeat
           family protein similar to PAK/PLC-interacting protein 1
           (GI:4211689)  {Homo sapiens}
          Length = 1115

 Score = 34.7 bits (76), Expect = 0.051
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H   ++   LS  G   LSGS DKT+R+W +  GK
Sbjct: 894 HKSTVTCFSLSETGECVLSGSADKTIRVWQIVKGK 928


>At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           similar to WDR protein, form B (GI:14970593) [Mus
           musculus]
          Length = 1589

 Score = 34.7 bits (76), Expect = 0.051
 Identities = 31/117 (26%), Positives = 51/117 (43%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S   ++ KP S M + ++    LRGH   V   A   +    +++ S D+ + +W +   
Sbjct: 280 SACHAIAKP-STMVQKMQNIKKLRGHRNAV-YCAIFDRSGRYVITGSDDRLVKIWSM--- 334

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           E    +   R  GH   I+D+ +SS+     S S D  +R+W L  G        HT
Sbjct: 335 ETALCLASCR--GHEGDITDLAVSSNNALVASASNDFVIRVWRLPDGMPISVLRGHT 389



 Score = 33.1 bits (72), Expect = 0.16
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 12/92 (13%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDM--ILSSSRDKTLIVWK------LTR----DENNYGIPQKR 214
           LRGH G VT IA +P+   +  +LSSS D T  +W       L R      ++       
Sbjct: 385 LRGHTGAVTAIAFSPRQASVYQLLSSSDDGTCRIWDARYSQWLPRIYVPSPSDANTGSTS 444

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
               SH I     +++G   ++GS D   R+W
Sbjct: 445 NASQSHQILCCAYNANGTIFVTGSSDSNARVW 476


>At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat
           family protein contains similarity to cockayne syndrome
           complementation group A protein GB:U28413 GI:975301 from
           [Homo sapiens]; confirmed by cDNA gi:1598289
          Length = 450

 Score = 34.7 bits (76), Expect = 0.051
 Identities = 14/41 (34%), Positives = 23/41 (56%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           R   H   ++ +  ++DG Y LS   D  +RLWD+ +G+ T
Sbjct: 307 RATAHYGAVTGLKATNDGMYLLSAGSDSRIRLWDIESGRNT 347


>At5g43920.1 68418.m05372 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to will die slowly protein (WDS) (SP:Q9V3J8)
           [Drosophila melanogaster]
          Length = 523

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH+  V  ++ NPK P M+ S+S D+T+ +W
Sbjct: 481 LSGHSMTVNCVSWNPKNPRMLASASDDQTIRIW 513


>At5g21040.1 68418.m02503 F-box family protein / WD-40 repeat family
           protein contains G-protein beta WD-40 repeats
          Length = 539

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           RL+GH   I+ + L  D     SGSWD ++R+WD ++ K  +
Sbjct: 252 RLWGHEGPITSLAL--DMTSIFSGSWDMSVRIWDRSSMKCVK 291



 Score = 31.9 bits (69), Expect = 0.36
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           LYGH+  +  V L +      +  +D  +R+WD+  G
Sbjct: 158 LYGHTEAVRTVFLLASAKLVFTSGYDSIVRMWDMEEG 194


>At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 WD
           repeats (PF00400); similar to Fzr1 (GI:6463679) {Homo
           sapiens}; similar to WD repeat protein Srw1
           -Schizosaccharomyces pombe,PID:d1023012
          Length = 475

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 26/95 (27%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH   V  +A +     ++ S SRDK+++   +   E++      +L GH   I  +
Sbjct: 246 TMEGHRLRVGALAWSSS---VLSSGSRDKSILQRDIRTQEDHVS----KLKGHKSEICGL 298

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             SSD     SG  D  L +W+  + +   RF +H
Sbjct: 299 KWSSDNRELASGGNDNKLFVWNQHSTQPVLRFCEH 333



 Score = 33.1 bits (72), Expect = 0.16
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GHS+ +  + +S DG   ++G+ D+TLR W++
Sbjct: 418 LTGHSYRVLYLAVSPDGQTIVTGAGDETLRFWNV 451


>At3g13300.2 68416.m01675 transducin family protein / WD-40 repeat
           family protein contains 2 WD-40 repeats (PF00400);
           autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens]
           and autoantigen locus HSU17474 (GI:596134) [Homo
           sapiens]
          Length = 1309

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           LR   RGH+  VT +A   +  DM+ S S D  + VWK++        PQ
Sbjct: 194 LRSLFRGHSQRVTDMAFFAEDVDMLASVSLDGKVFVWKISEGSEGEDQPQ 243


>At3g13300.1 68416.m01674 transducin family protein / WD-40 repeat
           family protein contains 2 WD-40 repeats (PF00400);
           autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens]
           and autoantigen locus HSU17474 (GI:596134) [Homo
           sapiens]
          Length = 1344

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           LR   RGH+  VT +A   +  DM+ S S D  + VWK++        PQ
Sbjct: 229 LRSLFRGHSQRVTDMAFFAEDVDMLASVSLDGKVFVWKISEGSEGEDQPQ 278


>At3g01340.1 68416.m00051 protein transport protein SEC13 family
           protein / WD-40 repeat family protein similar to Protein
           transport protein SEC13 SP|Q04491 {Saccharomyces
           cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris]
          Length = 302

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWK 172
           TL GH G V Q+A  +PK+  ++ S S D  +I+WK
Sbjct: 51  TLTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWK 86


>At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat
           family protein similar to SEC13-related protein
           (SP:P55735) [Homo sapiens]
          Length = 302

 Score = 33.9 bits (74), Expect = 0.089
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWK 172
           TL GH G V ++A  +PKY  ++ S S D  +I+WK
Sbjct: 51  TLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWK 86


>At1g21650.1 68414.m02710 preprotein translocase secA family protein
           contains Pfam profiles: PF01043 SecA protein, amino
           terminal region, PF00400 WD domain, G-beta repeat,
           PF00097 zinc finger, C3HC4 type (RING finger)
          Length = 1579

 Score = 33.9 bits (74), Expect = 0.089
 Identities = 22/63 (34%), Positives = 33/63 (52%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + S D T+  W L +D    G     + GH   +S +V+ +   Y  SGSWD T+RLW
Sbjct: 600 VYTGSGDNTIKAWSL-QD----GSLLCTMSGHKSVVSTLVVVNGVLY--SGSWDGTVRLW 652

Query: 311 DLA 319
            L+
Sbjct: 653 SLS 655


>At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400); some
           similarity to a group of proteins with homology to
           mammalian apoptosis regulators identified in zebrafish
           (PUBMED:10917738)Apaf-1(gi:7677507)
          Length = 537

 Score = 33.5 bits (73), Expect = 0.12
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           H H ++ V LS D +   S S D T+  WD+++GK+
Sbjct: 144 HQHSVTGVALSDDDSRGFSVSKDGTILHWDVSSGKS 179


>At4g35370.1 68417.m05025 transducin family protein / WD-40 repeat
           family protein contains 4 (3 significant) WD-40 repeats;
           similar to periodic tryptophan protein 1 homolog  
           (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610)
           (PIR2:I39360) [Homo sapiens]
          Length = 414

 Score = 33.1 bits (72), Expect = 0.16
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           N   SGS DK +++WD+A GK     E H K
Sbjct: 228 NIVASGSEDKKVKVWDVATGKCKVTMEHHEK 258


>At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related
            contains Pfam PF02138: Beige/BEACH domain; contains Pfam
            PF00400: WD domain, G-beta repeat (3 copies)
          Length = 2946

 Score = 33.1 bits (72), Expect = 0.16
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 218  YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            +GH   ++ + LS D N+ ++GS D T+ LW +    T+R
Sbjct: 2665 FGHCAPVTCLALSPDNNFLVTGSRDSTVLLWRIHKAFTSR 2704



 Score = 28.3 bits (60), Expect = 4.4
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
            S+  K   T  GH   VT +A +P   + +++ SRD T+++W++
Sbjct: 2655 SDGAKTLETAFGHCAPVTCLALSPDN-NFLVTGSRDSTVLLWRI 2697


>At1g76260.1 68414.m08855 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           similar to retinoblastoma A associated protein; RbAp48
           (GI:3309245) [Xenopus laevis]
          Length = 350

 Score = 33.1 bits (72), Expect = 0.16
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH  W   +  NP+Y ++ILS   D  + +W
Sbjct: 248 LPGHTHWTWAVRCNPEYEELILSVGTDSAVNLW 280


>At1g20540.1 68414.m02559 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           similar to Rbap46 polypeptide (GI:9454362) [Gallus
           gallus]
          Length = 351

 Score = 33.1 bits (72), Expect = 0.16
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH  W   +  NP+Y  +ILS+  D  + +W
Sbjct: 248 LPGHTHWTWAVRCNPEYDGLILSAGTDSVVNLW 280


>At4g29380.1 68417.m04197 protein kinase family protein / WD-40 repeat
            family protein contains Pfam PF00400: WD domain, G-beta
            repeat; contains Pfam PF00069: Protein kinase domain;
            contains PF02985: HEAT repeat; similar to adaptor protein
            (GI:1817584) [Homo sapiens]; similar to VPS15 protein
            (GI:6103009) [Pichia pastoris]
          Length = 1494

 Score = 32.7 bits (71), Expect = 0.21
 Identities = 13/39 (33%), Positives = 23/39 (58%)
 Frame = +2

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            G+    L  H   ++D+  SSD ++ +S S D T+++WD
Sbjct: 1071 GVLVAHLQEHRSAVNDIATSSDHSFFVSASDDSTVKVWD 1109



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            M++ S+++  + +W    D + + +      G   ++S +V S  GN+ +SGS    L L
Sbjct: 1203 MVMYSTQNCGIHLWDTRSDLDAWTLKANPEEG---YVSSLVTSPCGNWFVSGSSRGVLTL 1259

Query: 308  WDL 316
            WDL
Sbjct: 1260 WDL 1262


>At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400); U3
           snoRNP-associated 55-kDa protein, Homo sapiens,
           gb:NP_004695;  Vegetatible incompatibility protein
           HET-E-1 (SP:Q00808) [Podospora anserina]
          Length = 504

 Score = 32.7 bits (71), Expect = 0.21
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           H   +  V LS D +   S S D T+  WD+++GKT +
Sbjct: 160 HRRSVVSVALSDDDSRGFSASKDGTIMHWDVSSGKTDK 197



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 2/76 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIP--QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + S   DK   +W       ++G+   + R   HS     + +SSDG Y  +G  D+ + 
Sbjct: 190 VSSGKTDK--YIWPSDEILKSHGMKLREPRNKNHSRESLALAVSSDGRYLATGGVDRHVH 247

Query: 305 LWDLAAGKTTRRFEDH 352
           +WD+   +  + F  H
Sbjct: 248 IWDVRTREHVQAFPGH 263


>At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat
           family protein contains 4 WD-40 repeats (PF00400);
           similar to block of proliferation protein Bop1
           (GI:1679772) [Mus musculus]
          Length = 753

 Score = 32.7 bits (71), Expect = 0.21
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           GH+  ++ +   S G +  SGS D ++R+W++  G+
Sbjct: 421 GHTGAVTSISTDSSGEWIASGSTDGSVRMWEVETGR 456


>At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 698

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 21/79 (26%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+G +  I+ +    + +LS+S D ++ +W++   E+  GI     + H+++++ V  +
Sbjct: 354 GHSGDILDISWSKN--NRLLSASVDNSVRLWQIGC-EDCLGI-----FSHNNYVTSVQFN 405

Query: 257 S-DGNYALSGSWDKTLRLW 310
             D ++ +SGS D  +R+W
Sbjct: 406 PVDDDHFISGSIDGKVRIW 424



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           HN +VT +  NP   D  +S S D  + +W  ++
Sbjct: 395 HNNYVTSVQFNPVDDDHFISGSIDGKVRIWSASQ 428


>At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 694

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 21/79 (26%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+G +  I+ +    + +LS+S D ++ +W++   E+  GI     + H+++++ V  +
Sbjct: 354 GHSGDILDISWSKN--NRLLSASVDNSVRLWQIGC-EDCLGI-----FSHNNYVTSVQFN 405

Query: 257 S-DGNYALSGSWDKTLRLW 310
             D ++ +SGS D  +R+W
Sbjct: 406 PVDDDHFISGSIDGKVRIW 424



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           HN +VT +  NP   D  +S S D  + +W  ++
Sbjct: 395 HNNYVTSVQFNPVDDDHFISGSIDGKVRIWSASQ 428


>At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pfam
           profile PF00400: WD domain, G-beta repeat
          Length = 580

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           R H+G+VT++     +  +++SSS DKTL +W L +
Sbjct: 451 RAHDGYVTKLVAPESH--LLVSSSLDKTLRIWDLRK 484



 Score = 30.7 bits (66), Expect = 0.83
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           H  +++ +V + + +  +S S DKTLR+WDL    T + F
Sbjct: 453 HDGYVTKLV-APESHLLVSSSLDKTLRIWDLRKSWTPQPF 491


>At5g14530.1 68418.m01703 transducin family protein / WD-40 repeat
           family protein similar to Will die slowly protein
           (SP:Q9V3J8) [Drosophila melanogaster] ; contains Pfam
           PF00400: WD domain, G-beta repeat (4 copies, 1 weak)
          Length = 330

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 14/40 (35%), Positives = 21/40 (52%)
 Frame = +2

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +   + DG Y LSGS D TL  W++       R+E++  V
Sbjct: 249 EATFTPDGKYVLSGSGDGTLHAWNIENPSEVARWENNIGV 288



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +2

Query: 119 YPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDK 295
           +P  ++ SSR       +  R  + Y     R + GH   +  + +S   +  +SGS D+
Sbjct: 77  HPSSLICSSRYNLESTGESLRYLSMYDNRILRYFKGHKDRVVSLCMSPINDSFMSGSLDR 136

Query: 296 TLRLWDL 316
           ++RLWDL
Sbjct: 137 SVRLWDL 143


>At4g34380.1 68417.m04884 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to Myosin heavy chain kinase B (MHCK
           B).(SP:P90648) [Dictyostelium discoideum]
          Length = 495

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 21/85 (24%), Positives = 39/85 (45%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL 277
           ++ T P +  M+ SS   K  +  ++ R+ N+  +  K    H+  +S + L  +     
Sbjct: 200 RVGTLPTFKSMVKSSVNPKHFM--EVRRNRNS--VKTK----HNDAVSSLSLDVELGLLY 251

Query: 278 SGSWDKTLRLWDLAAGKTTRRFEDH 352
           S SWD T+++W +A  K       H
Sbjct: 252 SSSWDTTIKVWRIADSKCLESIHAH 276


>At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat
           family protein similar to Sec31p (GI:13928450)  {Oryza
           sativa}
          Length = 969

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 5/108 (4%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G   L+ P S  S  +     L  H G V  +  N K P+ + S + D T+ +W L    
Sbjct: 90  GNIGLWNPISSESGEIAHVRDLSKHKGPVRGLEFNVKSPNQLASGADDGTVCIWDLA--- 146

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYAL-----SGSWDKTLRLWDL 316
            N   P   L G   ++   + S   N        S S + T  +WD+
Sbjct: 147 -NPSKPSHYLKGTGSYMQSEISSLSWNKGFQHVLASTSHNGTTVIWDV 193


>At5g23730.1 68418.m02782 transducin family protein / WD-40 repeat
           family protein contains similarity to photomorphogenesis
           repressor protein; contains Pfam PF00400: WD domain,
           G-beta repeat (5 copies)
          Length = 243

 Score = 31.9 bits (69), Expect = 0.36
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           P   L GH+  +S V     G    +G+ D  L+LW +  G+  R +E H
Sbjct: 105 PALTLQGHTKTVSYVRFLDGGTVVTAGT-DGCLKLWSVEDGRVIRTYEGH 153


>At4g38480.1 68417.m05438 transducin family protein / WD-40 repeat
           family protein contains contains Pfam PF00400: WD
           domain, G-beta repeat (7 copies, 3 weak);similar to gene
           PC326 protein - mouse, PIR2:S37694
          Length = 471

 Score = 31.9 bits (69), Expect = 0.36
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           K+L  H   ++ V  ++DG+  LSGS D+ + LWD         F+
Sbjct: 49  KKLDKHKGCVNTVSFNADGDILLSGSDDRQVILWDWQTASVKLSFD 94


>At4g22910.1 68417.m03309 WD-40 repeat family protein contains 6
           WD-40 repeats (PF00400); similar to fizzy-related
           protein (GI:5813825) Drosophila melanogaster,
           PID:g2326419;
          Length = 518

 Score = 31.9 bits (69), Expect = 0.36
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH++ +  + +S DG   ++G+ D+TLR W++
Sbjct: 461 LTGHTYRVLYLAVSPDGQTIVTGAGDETLRFWNV 494



 Score = 31.5 bits (68), Expect = 0.47
 Identities = 23/96 (23%), Positives = 43/96 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH   V  +A       ++ S SRDK+++   +   E++      +L GH   +  +
Sbjct: 289 TMEGHRLRVGALAWGSS---VLSSGSRDKSILQRDIRCQEDHVS----KLAGHKSEVCGL 341

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S D     SG  D  L +W+  + +   ++ +HT
Sbjct: 342 KWSYDNRELASGGNDNRLFVWNQHSTQPVLKYSEHT 377


>At2g26490.1 68415.m03178 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           related to En/Spm transposon family of maize
          Length = 465

 Score = 31.5 bits (68), Expect = 0.47
 Identities = 12/43 (27%), Positives = 22/43 (51%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H+  +S + L+ +     S SWD+T+++W +A  K       H
Sbjct: 205 HADAVSCLSLNDEQGLLYSASWDRTIKVWRIADSKCLESIPAH 247



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 9/113 (7%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G S     F +  + L   G L+GH   V  +        ++ S S DKT+ VWK  RD 
Sbjct: 313 GSSDGLVNFWEREKQLNYGGILKGHKLAVLCLEVAGS---LVFSGSADKTICVWK--RDG 367

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGN---------YALSGSWDKTLRLWDLA 319
           N +      L GH+  +  + + +D              SGS DK++++W ++
Sbjct: 368 NIHTC-LSVLTGHTGPVKCLAVEADREASERRDKKWIVYSGSLDKSVKVWGVS 419



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 17/61 (27%), Positives = 32/61 (52%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+S D+T+ VW++   +    IP      H   ++ VV +++     SGS D T++ 
Sbjct: 220 LLYSASWDRTIKVWRIADSKCLESIP-----AHDDAVNSVVSTTEA-IVFSGSADGTVKA 273

Query: 308 W 310
           W
Sbjct: 274 W 274



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 25/84 (29%), Positives = 37/84 (44%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL      VT +A +     +   SS D  +  W+  +  N  GI    L GH   +
Sbjct: 287 LMQTLTKQESAVTALAVSKNGAAVYFGSS-DGLVNFWEREKQLNYGGI----LKGHK--L 339

Query: 239 SDVVLSSDGNYALSGSWDKTLRLW 310
           + + L   G+   SGS DKT+ +W
Sbjct: 340 AVLCLEVAGSLVFSGSADKTICVW 363


>At1g19750.1 68414.m02469 transducin family protein / WD-40 repeat
           family protein similar to Cockayne syndrome
           complementaion group A proteins (GI:18077663)[Mus
           musculus] and (SP:Q13216)[Homo sapiens]; confirmed by
           full-length cDNA GI:15982896
          Length = 450

 Score = 31.5 bits (68), Expect = 0.47
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           R   H   ++ +  ++DG Y LS      +RLWD+ +G+ T
Sbjct: 307 RATAHYGVVTGLKATNDGMYLLSAGSYSRIRLWDIESGRNT 347


>At5g58760.1 68418.m07360 transducin family protein / WD-40 repeat
           family protein contains 4 WD-40 repeats (PF00400);
           damage-specific DNA binding protein 2 (GI:10798819)
           [Homo sapiens]
          Length = 557

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 3/75 (4%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVW---KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALS 280
           NP  P+++LS   D    +W   KL    + + +  KR+   ++F       S G   L+
Sbjct: 321 NPVQPELLLSCGNDHFARIWDMRKLQPKASLHDLAHKRVVNSAYF-----SPSSGTKILT 375

Query: 281 GSWDKTLRLWDLAAG 325
              D  +R+WD   G
Sbjct: 376 TCQDNRIRIWDSIFG 390


>At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat
           family protein fizzy-related (FZR); contains 6 WD-40
           repeats (PF00400); WD-repeat protein,
           carrot,(gi:2253631) PIR:T14352
          Length = 428

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 6/51 (11%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWD--LAAGKTTR----RFEDHT 355
           GH+  +  +  S  G    SG  D  + +WD  LA+   TR    RFE+HT
Sbjct: 234 GHTEEVCGLKWSESGKKLASGGNDNVVHIWDRSLASSNPTRQWLHRFEEHT 284



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL--AAGKTTRR 340
           +    L GH+  +  +  S DG    S + D+TLRLW++     KTT++
Sbjct: 363 VKMAELNGHTSRVLFMAQSPDGCTVASAAGDETLRLWNVFGEPPKTTKK 411


>At4g35140.1 68417.m04996 transducin family protein / WD-40 repeat
           family protein contains 6 (3 significant) WD-40 repeats;
            similar to PC326 protein  (GI:200241) (PIR2:S37694)
           [Mus musculus]; Human (H326) mRNA, Homo sapiens,
           gb:U06631
          Length = 496

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           K+L  H   ++ V  +++G+  +SGS D+ + LWD   G     F
Sbjct: 53  KKLEKHKGCVNTVSFNAEGDVLISGSDDRRVVLWDWQLGNVKLSF 97


>At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome
           A-related contains 7 WD-40 repeats (PF00400); similar to
           phytochrome A supressor spa1  (GI:4809171) [Arabidopsis
           thaliana]; contains non-consensus (GC) donor splice
           sites at introns 4 and 6
          Length = 1017

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           NY  S  +D  ++LWD+  G+    F +H K
Sbjct: 767 NYLASSDYDGIVKLWDVTTGQAISHFIEHEK 797


>At3g51930.1 68416.m05696 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           myosin heavy chain kinase B (SP:P90648)(GI:1903458)
           [Dictyostelium discoideum]
          Length = 415

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           KRL+   H  S   L+       SGSWDKTL++W L+  K     + H
Sbjct: 167 KRLW-IEHADSISCLAVHAGIIYSGSWDKTLKVWRLSDLKCLESIKAH 213



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  +L    RGHN  V  +       +M+ S S DK++ +W+  R+          ++GH
Sbjct: 306 EEWRLGFETRGHNMAVLCMCV---VGEMVCSGSADKSIGLWR--REVTGMLCKFGVIHGH 360

Query: 227 SHFISDVVLSSD----GNYALSGSWDKTLRLW 310
              +  +  S +    G    SG  DK+LR+W
Sbjct: 361 EGPVKCLQASPNNVGAGFMLYSGGLDKSLRVW 392


>At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic
           checkpoint protein, putative contains 5 WD-40 repeats
           (PF00400) (1 weak); similar to testis mitotic checkpoint
           protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens]
          Length = 339

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 18/57 (31%), Positives = 26/57 (45%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           K+ R + N G  +  L  H   +  V  S      ++GSWDKT++ WD      T R
Sbjct: 79  KVRRIDFNAG-KEDVLGTHEKPVRCVEYSYAAGQVITGSWDKTIKCWDPRGASGTER 134



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 11/26 (42%), Positives = 20/26 (76%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWD 313
           IS++  S++ ++ L  SWDK++RL+D
Sbjct: 19  ISNLRFSNNSDHLLVSSWDKSVRLYD 44


>At1g17720.2 68414.m02194 serine/threonine protein phosphatase 2A
           (PP2A) 55 kDa regulatory subunit B identical to type 2A
           protein serine/threonine phosphatase 55 kDa B regulatory
           subunit (GI:1408460) [Arabidopsis thaliana]; similar to
           55 kDa B regulatory subunit of phosphatase 2A GI:710330;
           contains Pfam PF00400: WD domain, G-beta repeat (5
           copies, 3 weak)
          Length = 500

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ISD+  S DG Y LS  +  TL+LWD+
Sbjct: 332 ISDIKFSKDGRYILSRDY-MTLKLWDI 357


>At1g17720.1 68414.m02193 serine/threonine protein phosphatase 2A
           (PP2A) 55 kDa regulatory subunit B identical to type 2A
           protein serine/threonine phosphatase 55 kDa B regulatory
           subunit (GI:1408460) [Arabidopsis thaliana]; similar to
           55 kDa B regulatory subunit of phosphatase 2A GI:710330;
           contains Pfam PF00400: WD domain, G-beta repeat (5
           copies, 3 weak)
          Length = 501

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ISD+  S DG Y LS  +  TL+LWD+
Sbjct: 333 ISDIKFSKDGRYILSRDY-MTLKLWDI 358


>At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6
           WD-40 repeats (PF00400); similar to Fzr1
           (GI:6463679){Homo sapiens}
          Length = 481

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GHS  +  +  S DG   ++G+ D+TLR W++
Sbjct: 424 LTGHSMRVLYLATSPDGQTIVTGAGDETLRFWNV 457



 Score = 28.3 bits (60), Expect = 4.4
 Identities = 22/96 (22%), Positives = 44/96 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH      +A N +   ++ S SRD+ ++   + R ++++     +L GH   +  +
Sbjct: 252 TMGGHQTRTGVLAWNSR---ILSSGSRDRNILQHDI-RVQSDF---VSKLVGHKSEVCGL 304

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S D     SG  D  L +W+  + +   +  +HT
Sbjct: 305 KWSHDDRELASGGNDNQLLVWNNHSQQPILKLTEHT 340


>At4g29860.1 68417.m04250 transducin family protein / WD-40 repeat
           family protein contains 3 WD-40 repeats (PF00400); WDVCF
           variant 1 (gi:12006981) [Mus musculus]
          Length = 386

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           P   L GH H + DV      +   +GS D  LR+WD
Sbjct: 9   PVAVLRGHRHSVMDVSFHPSKSLLFTGSADGELRIWD 45


>At4g01860.2 68417.m00244 transducin family protein / WD-40 repeat
           family protein contains ten G-protein beta-subunit
           (beta-transducin) WD-40 repeats
          Length = 1308

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           RL GH   I  +V S DG+  +S S D++ R+W++
Sbjct: 230 RLTGHEGSIFRIVWSLDGSKIVSVSDDRSARIWEI 264


>At4g01860.1 68417.m00243 transducin family protein / WD-40 repeat
           family protein contains ten G-protein beta-subunit
           (beta-transducin) WD-40 repeats
          Length = 1308

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           RL GH   I  +V S DG+  +S S D++ R+W++
Sbjct: 230 RLTGHEGSIFRIVWSLDGSKIVSVSDDRSARIWEI 264


>At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical
           protein contains similarity to ec31p [Oryza sativa]
           gi|13928450|dbj|BAB47154; contains Pfam profile PF00400:
           WD domain, G-beta repeat
          Length = 1102

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 7/120 (5%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--N 193
           L KP S+ S    L+G+     G ++ I+ N K   ++ S+S + T ++W L + +   N
Sbjct: 152 LLKP-SEPSHFPLLKGSGSATQGEISFISWNRKVQQILASTSYNGTTVIWDLRKQKPIIN 210

Query: 194 YGIPQKR----LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA-AGKTTRRFEDHTK 358
           +    +R    L  + +  + ++++SD + +       TL+LWD+       R F  H +
Sbjct: 211 FADSVRRRCSVLQWNPNVTTQIMVASDDDSS------PTLKLWDMRNIMSPVREFTGHQR 264


>At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical
           protein contains similarity to ec31p [Oryza sativa]
           gi|13928450|dbj|BAB47154; contains Pfam profile PF00400:
           WD domain, G-beta repeat
          Length = 1104

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 7/120 (5%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--N 193
           L KP S+ S    L+G+     G ++ I+ N K   ++ S+S + T ++W L + +   N
Sbjct: 152 LLKP-SEPSHFPLLKGSGSATQGEISFISWNRKVQQILASTSYNGTTVIWDLRKQKPIIN 210

Query: 194 YGIPQKR----LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA-AGKTTRRFEDHTK 358
           +    +R    L  + +  + ++++SD + +       TL+LWD+       R F  H +
Sbjct: 211 FADSVRRRCSVLQWNPNVTTQIMVASDDDSS------PTLKLWDMRNIMSPVREFTGHQR 264


>At3g45620.1 68416.m04927 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats;  similar to
           PC326 protein  (GI:200241) (PIR2:S37694) [Mus
           musculus];Human (H326) translated mRNA - Homo sapiens,
           EMBL:HS06631
          Length = 481

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +L GH   ++ V  +S G+  +SGS D+ + LW+  +G
Sbjct: 50  KLNGHEGCVNAVEFNSTGDVLVSGSDDRQIMLWNWLSG 87


>At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-related
            contains Pfam PF00400: WD domain, G-beta repeat; similar
            to Lipopolysaccharide-responsive and beige-like anchor
            protein (CDC4-like protein) (Beige-like protein)
            (SP:P50851) [Homo sapiens}
          Length = 1280

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 11/39 (28%), Positives = 22/39 (56%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
            H   +S V +++D     +GS+D T+ +WD+   +T  +
Sbjct: 1045 HKDVVSCVAVTADSTILATGSYDTTVMVWDILRMRTPEK 1083


>At1g47610.1 68414.m05288 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to En/Spm-like transposon protein (GI:2739374)
           [Arabidopsis thaliana]
          Length = 351

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           HS  +S + L+ D     S SWD+T+++W +   K     + H
Sbjct: 134 HSDAVSCLSLAEDQGLLYSASWDRTVKVWRIHDLKCIESIKAH 176


>At5g66240.2 68418.m08345 transducin family protein / WD-40 repeat
           family protein contains Pfam PF00400: WD domain, G-beta
           repeat (4 copies, 1 weak); similar to Will die slowly
           protein. {Drosophila melanogaster} (SP:Q9V3J8)
           {Drosophila melanogaster}
          Length = 331

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
 Frame = +2

Query: 119 YPDMILSSSR---DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           +P  ++ SSR   D +L +  L+  +N Y    +   GH   +  + L S G   +SGS 
Sbjct: 86  HPTTVIYSSRNGWDDSLRL--LSLHDNKY---LRYFKGHHDRVVSLSLCSGGECFISGSL 140

Query: 290 DKTLRLWD 313
           D+T+ LWD
Sbjct: 141 DRTVLLWD 148


>At5g66240.1 68418.m08344 transducin family protein / WD-40 repeat
           family protein contains Pfam PF00400: WD domain, G-beta
           repeat (4 copies, 1 weak); similar to Will die slowly
           protein. {Drosophila melanogaster} (SP:Q9V3J8)
           {Drosophila melanogaster}
          Length = 328

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
 Frame = +2

Query: 119 YPDMILSSSR---DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           +P  ++ SSR   D +L +  L+  +N Y    +   GH   +  + L S G   +SGS 
Sbjct: 83  HPTTVIYSSRNGWDDSLRL--LSLHDNKY---LRYFKGHHDRVVSLSLCSGGECFISGSL 137

Query: 290 DKTLRLWD 313
           D+T+ LWD
Sbjct: 138 DRTVLLWD 145


>At4g18905.1 68417.m02787 transducin family protein / WD-40 repeat
           family protein contains 5 (4 significant) WD-40 repeats;
           similar to periodic tryptophan protein 1 homolog
           (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610)
           (PIR2:I39360) [Homo sapiens]
          Length = 494

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           N   S S DK +++WD+A G      E HTK
Sbjct: 279 NILASASADKKVKVWDVATGTCKITMEHHTK 309


>At3g13290.1 68416.m01673 transducin family protein / WD-40 repeat
           family protein contains 2 WD-40 repeats (PF00400);
           autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens]
           and autoantigen locus HSU17474 (GI:596134) [Homo
           sapiens]
          Length = 1322

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           LR   RGH+  VT +A   +   ++ S S D  + VWK++  E + G  Q ++ G
Sbjct: 213 LRSLFRGHSQRVTDMAFFAEDVHLLASVSLDGKVFVWKIS--EGSEGDEQSQITG 265


>At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat
           family protein similar to signal transducer and
           activator of transcription interacting protein 1
           (GI:15929722) {Mus musculus}; similar to hypothetical
           protein GB:AAD43147 GI:5430747 from (Arabidopsis
           thaliana); contains Pfam PF00400: WD domain, G-beta
           repeat (11 copies, 2 weak)
          Length = 840

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 8/101 (7%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIV---WKL-----TRDEN 190
           SK SE  +++    GH   VT + T  +  + +LS S+D+T  V   WK        DE+
Sbjct: 399 SKESENWQMQKVPSGHFAAVTDV-TWARTGEYLLSVSQDQTTRVFSAWKNDEGNEAEDEH 457

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            + + + +++GH      +V     +  +SG+ +K +R+++
Sbjct: 458 WHELARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFE 498



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 8/43 (18%)
 Frame = +2

Query: 71  LRGHNGWVTQIA------TNPKYPD--MILSSSRDKTLIVWKL 175
           L+GH  W+  +       T  + P+  M++SSS+DK + +WKL
Sbjct: 219 LKGHTDWIRSLDFSLPLHTTEEIPNSIMLVSSSQDKVIRIWKL 261



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/43 (30%), Positives = 21/43 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           KL   +  H   +   + NP +     +SSRDKT+ +W +  D
Sbjct: 687 KLMAKVEAHKRIIWACSWNP-FGHQFATSSRDKTVKIWSVEND 728


>At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic
           checkpoint protein, putative contains 5 WD-40 repeats
           (PF00400) (1 weak); similar to testis mitotic checkpoint
           protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens]
          Length = 340

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 12/36 (33%), Positives = 22/36 (61%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           IS++  S++ ++ L  SWDK +RL+D++       F
Sbjct: 20  ISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF 55



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           H   +  V  S      ++GSWDKT++ WD
Sbjct: 97  HDKAVRCVEYSYAAGQVITGSWDKTVKCWD 126


>At3g15354.1 68416.m01939 WD-40 repeat family protein / phytochrome
           A-related contains 7 WD-40 repeats (PF00400);
           phytochrome A supressor spa1 (GI:4809171) [Arabidopsis
           thaliana]
          Length = 837

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 3/76 (3%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDM--ILSSSRDKTLIVWKLTRDENNYG-IPQKRLYGHSHFI 238
           T+ GH+  V+ +    K+ D   ++SSS D TL +W L+   +     P     GH++  
Sbjct: 699 TMIGHSKTVSYV----KFVDSSTLVSSSTDNTLKLWDLSMSASGINESPLHSFTGHTNLK 754

Query: 239 SDVVLSSDGNYALSGS 286
           + V LS    Y  +GS
Sbjct: 755 NFVGLSVSDGYIATGS 770


>At2g35860.1 68415.m04403 beta-Ig-H3 domain-containing protein /
           fasciclin domain-containing protein contains Pfam
           profile PF02469: Fasciclin domain
          Length = 445

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)
 Frame = -2

Query: 533 IYNTIIILPSYLRLLQH--KHNLLPRKGTK-HWSSASHRHLGLSSVHNQHLH 387
           ++ + ++ P  L+ LQ     ++LP++ T   W S SH H  LS   N HLH
Sbjct: 90  LFKSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLSHHHRTLS---NDHLH 138


>At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat
           family protein contains 10 WD-40 repeats (PF00400);
           similar to 66kDa stress protein (SWISS-PROT: P90587)[
           Physarum polycephalum (Slime mold)]
          Length = 474

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 26/92 (28%), Positives = 39/92 (42%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   + R H+ +V  I  +P     I  SS  K +I    T D+      +    GH   
Sbjct: 42  KFHSSHREHSNFVNCIRYSPDGTKFITVSSDKKGMIYDGKTGDKVGELASED---GHKGS 98

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           I  V  S D    L+ S DK+ ++W++A   T
Sbjct: 99  IYAVSWSPDSKRVLTVSADKSAKVWEVAEDGT 130


>At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5
           WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595)
           {Xenopus laevis}; similar to "Will die slowly" protein,
           Drosophia; putative cdc20 protein - Arabidopsis
           thaliana, EMBL:AF029262
          Length = 411

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL--AAGKTTRR 340
           +    L GH+  +  +  S DG    S + D+TLRLW++     KTT++
Sbjct: 346 VKMAELNGHTSRVLFMAQSPDGCTVASAAGDETLRLWNVFGEPPKTTKK 394



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 7/52 (13%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWD---LAAGKTTR----RFEDHT 355
           GH+  +  +  S  G    SG  D  + +WD   +A+   TR    RFE+HT
Sbjct: 216 GHTEEVCGLKWSESGKKLASGGNDNVVHIWDHRSVASSNPTRQWLHRFEEHT 267


>At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5
           WD-40 repeats (PF0400);  similar to WD-40 repeat protein
           MSI4 (SP:O22607) [Arabidopsis thaliana]
          Length = 496

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 22/84 (26%), Positives = 32/84 (38%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           RG   GH   V  +A  P       S   D  L++W      +     +K      H + 
Sbjct: 274 RGIYNGHKDTVEDVAFCPSSAQEFCSVGDDSCLMLWDARTGTSPAMKVEKAHDADLHCVD 333

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
                 D N  L+GS D T+R++D
Sbjct: 334 --WNPHDNNLILTGSADNTVRVFD 355



 Score = 28.7 bits (61), Expect = 3.3
 Identities = 20/87 (22%), Positives = 37/87 (42%), Gaps = 8/87 (9%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY---GIPQKR----LYGHSHFI 238
           H G V +I   P+   ++ + +    +++W      + Y   G P  R    L GH    
Sbjct: 152 HPGEVNRIRELPQNSKIVATHTDSPDILIWNTETQPDRYAVLGAPDSRPDLLLIGHQDDA 211

Query: 239 S-DVVLSSDGNYALSGSWDKTLRLWDL 316
              + +     + LSG  DK++ LW++
Sbjct: 212 EFALAMCPTEPFVLSGGKDKSVILWNI 238


>At4g02660.1 68417.m00361 WD-40 repeat family protein / beige-related
            contains Pfam PF00400: WD domain, G-beta repeat; similar
            to BEIGE (GI:3928547) [Rattus norvegicus]; lysosomal
            trafficking regulator - Bos taurus, EMBL: AF114785
          Length = 3471

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 5/64 (7%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT-----RDENNYGIPQ 208
            S  L+L  +L  H   V  +  +  Y  MI SSS D T+I+W L+     R   N+ +P 
Sbjct: 3311 SRRLRLEKSLCAHTAKVICLRVSQPYM-MIASSSDDCTVIIWDLSSLSFVRQLPNFSVPV 3369

Query: 209  KRLY 220
              +Y
Sbjct: 3370 TVVY 3373


>At3g21060.1 68416.m02662 transducin family protein / WD-40 repeat
           family protein contains 4 WD-40 repeats (PF00400);
           similar to Retinoblastoma-binding protein 5 (RBBP-5)
           [Homo sapiens](RBQ-3)
          Length = 547

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWD--LAAGKTTRRFED 349
           + ++V S +G Y L+ S D+T+R+++  L A    +  ED
Sbjct: 219 VKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKNVLKSLED 258


>At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat
           family protein Similar to U4/U6 small nuclear
           ribonucleoprotein hPrp4  (gi:2708305)[Homo sapiens];
           contains 4  WD-40 repeats
          Length = 276

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 7/65 (10%)
 Frame = +2

Query: 137 SSSRD-KTLIVWKLTRDENNYGIPQKR-----LYGHSHFISDVVLSS-DGNYALSGSWDK 295
           S SRD K L+   L+     + +PQ       L GH   ++DVV SS D     + S D+
Sbjct: 70  SLSRDGKILVTCSLSGVPKLWEVPQVTNKIVVLKGHKEHVTDVVFSSVDDECLATASTDR 129

Query: 296 TLRLW 310
           T ++W
Sbjct: 130 TEKIW 134



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           SS  D    VW L R   N  I Q    GH   +  V  S +G +  SG  D   R+WDL
Sbjct: 147 SSGFDSLARVWDL-RTARNILIFQ----GHIKQVLSVDFSPNGYHLASGGEDNQCRIWDL 201

Query: 317 AAGK 328
              K
Sbjct: 202 RMRK 205


>At1g15470.1 68414.m01860 transducin family protein / WD-40 repeat
           family protein Strong similarity to gb AF096285
           serine-threonine kinase receptor-associated protein from
           Mus musculus and contains 5 PF|00400 WD40, G-beta repeat
           domains. EST gb|F14050 comes from this gene
          Length = 333

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           GH+  V  +A +P  PD   ++S+S+D   +   L   E    I      GH   +    
Sbjct: 9   GHSRPVVDVAYSPVTPDGFFLISASKDSNPM---LRNGETGDWIGT--FEGHKGAVWSCS 63

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           L  +   A S S D T ++W+   G     FE
Sbjct: 64  LDKNAIRAASASADFTAKIWNALTGDELHSFE 95


>At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-related
            similar to BEIGE (GI:3928547) [Rattus norvegicus];
            Similar to gb|U70015 lysosomal trafficking regulator from
            Mus musculus and contains 2 Pfam PF00400 WD-40, G-beta
            repeats. ESTs gb|T43386 and gb|AA395236 come from this
            gene
          Length = 3601

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 18/77 (23%), Positives = 39/77 (50%), Gaps = 3/77 (3%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIP---QKRLYGHSHFISDVVLSSDGNYALSGSWDKT 298
            ++++ + D  + VW++++D          +K L  H+  ++ + +S       SGS D T
Sbjct: 3344 IVVTGAEDGLVCVWRVSKDGPRGSRRLRLEKALCAHTAKVTCLRVSQPYMMIASGSDDCT 3403

Query: 299  LRLWDLAAGKTTRRFED 349
            + +WDL++    R+  D
Sbjct: 3404 VIIWDLSSLSFVRQLPD 3420


>At5g45760.2 68418.m05626 transducin family protein / WD-40 repeat
           family protein
          Length = 334

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%)
 Frame = +2

Query: 221 GHSHFISDVVLS---SDGNYALSGSWDKTLRLWD 313
           GH+  +S V  S     G + +SG  DKT+++WD
Sbjct: 246 GHNSAVSCVAFSLFQEKGRFLISGGNDKTVKIWD 279


>At5g45760.1 68418.m05625 transducin family protein / WD-40 repeat
           family protein
          Length = 360

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%)
 Frame = +2

Query: 221 GHSHFISDVVLS---SDGNYALSGSWDKTLRLWD 313
           GH+  +S V  S     G + +SG  DKT+++WD
Sbjct: 272 GHNSAVSCVAFSLFQEKGRFLISGGNDKTVKIWD 305


>At5g10940.1 68418.m01269 transducin family protein / WD-40 repeat
           family protein unnamed ORF cDNA FLJ10872, Homo sapiens,
           EMBL:AK001734; contains Pfam PF00400: WD domain, G-beta
           repeat (6 copies,1 weak)
          Length = 757

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 11/41 (26%), Positives = 25/41 (60%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           ++ L GH   ++ +  +S+G+  +SGS D  + +W+ ++ K
Sbjct: 43  EQELEGHQGCVNALAWNSNGSLLISGSDDLRINIWNYSSRK 83


>At4g21520.1 68417.m03110 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           similar to guanine nucleotide-binding protein beta 5
           (GI:1001939) [Mesocricetus auratus]
          Length = 425

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 24/100 (24%), Positives = 42/100 (42%), Gaps = 1/100 (1%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L +P     +   L+    G  G ++ +A +P    M+   S  +T  +++    E  Y 
Sbjct: 191 LHRPGRDFRQYSTLQKNKEGQAGILSTLAFSPTNSGMLAVGSYGQTTGIYREDNMELLYV 250

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDL 316
                L+G    ++ V  S DGNY  +G   D  +  WD+
Sbjct: 251 -----LHGQEGGVTHVQFSKDGNYLYTGGRKDPYILCWDI 285


>At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat
           family protein similar to 66 kDa stress protein
           (SP:P90587) [Physarum polycephalum (Slime mold)];
           similar to WDR1 protein GB:AAD05042 [Gallus gallus]
           (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40
           repeats (PF00400)
          Length = 609

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           GH   I  V  S DG   L+ S DK+ ++WD++
Sbjct: 230 GHKGSIYAVSWSPDGKQVLTVSADKSAKIWDIS 262



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +2

Query: 221 GHSHFISDV-VLSSDGNYALSGSWDKTLRLWDLAAG 325
           GH   +S + VL  + +Y LSGS+D  +  W L  G
Sbjct: 322 GHMKNVSSLAVLKGNADYILSGSYDGLICKWMLGRG 357


>At2g18900.1 68415.m02205 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           related to LACK protective antigen (GI:13625467)
           [Leishmania donovani]
          Length = 804

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           HS  ++ +  SSDG Y  SG  +  L +W L  GK
Sbjct: 282 HSAEVNVLNFSSDGAYLYSGGREGVLVVWQLDTGK 316


>At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat
           family protein contains 5 WD-40 repeats (PF00400);
           related to TGF-beta resistance-associated  protein TRAG
           (GI:15624071) {Mus musculus};  similar to
           beta-transducin repeats containing protein - Homo
           sapiens,PID:e1284220; 3' EST no_NP:TC8031
          Length = 1446

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +2

Query: 275 LSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +SGS D T+R+WDL +G        H
Sbjct: 553 ISGSMDCTIRIWDLESGNVIMIMHHH 578


>At2g43945.1 68415.m05462 expressed protein
          Length = 289

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 11/36 (30%), Positives = 23/36 (63%)
 Frame = -3

Query: 418 DYLQCIISIYTLTKLRVLSHLSMVLESSGSLACSEI 311
           D+++C++     + LR+ +    ++E SGS+A SE+
Sbjct: 91  DHIECVLESDEDSGLRIPTQAQAIVEGSGSVAVSEL 126


>At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochrome
           A-related contains 7 WD-40 repeats (PF00400) (1 below
           cutoff); similar to phytochrome A supressor spa1
           (GI:4809171) [Arabidopsis thaliana]
          Length = 794

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 1/74 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLYGHSHFISD 244
           T+ GH+  V+ +         ++SSS D TL +W L+   +     P     GH++  + 
Sbjct: 657 TMIGHHKTVSYVRFVDS--STLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNF 714

Query: 245 VVLSSDGNYALSGS 286
           V LS    Y  +GS
Sbjct: 715 VGLSVSDGYIATGS 728


>At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochrome
           A-related contains 7 WD-40 repeats (PF00400) (1 below
           cutoff); similar to phytochrome A supressor spa1
           (GI:4809171) [Arabidopsis thaliana]
          Length = 794

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 1/74 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLYGHSHFISD 244
           T+ GH+  V+ +         ++SSS D TL +W L+   +     P     GH++  + 
Sbjct: 657 TMIGHHKTVSYVRFVDS--STLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNF 714

Query: 245 VVLSSDGNYALSGS 286
           V LS    Y  +GS
Sbjct: 715 VGLSVSDGYIATGS 728


>At5g60050.1 68418.m07530 PRLI-interacting factor-related contains
           weak similarity to PRLI-interacting factor G
           (GI:11139264) [Arabidopsis thaliana]
          Length = 499

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +2

Query: 146 RDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           R+  ++++KL R+E +Y + +  LYG  H
Sbjct: 271 REMKVLIFKLVREEADYDVSRDTLYGLCH 299


>At3g13340.1 68416.m01679 WD-40 repeat family protein contains Pfam
           profile: PF00400 WD domain, G-beta repeat (3 copies, 1
           significant); similar to Trp-Asp repeat protein
           (PIR:T40094) [Schizosaccharomyces]
          Length = 447

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           N G   + L GH  F        DG    +G+ DKT R+WD+
Sbjct: 307 NTGKTLETLSGHLDFSFASAWHPDGVTFSTGNQDKTCRVWDI 348


>At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10
           WD-40 repeats (PF00400) (1 weak)
          Length = 1131

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 290 DKTLRLWDLAAGKTTRRFEDH 352
           DKT+++WD A G     FE H
Sbjct: 485 DKTIKVWDAATGVKRHTFEGH 505



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K   T        T +A +P+  ++I     D T+ ++ +  DE      + +L GHS
Sbjct: 865  TFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDE-----VKSKLKGHS 919

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWD 313
              I+ +  S+  N  +S   D  L +W+
Sbjct: 920  KRITGLAFSNVLNVLVSSGADAQLCVWN 947


>At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10
           WD-40 repeats (PF00400) (1 weak)
          Length = 1131

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 290 DKTLRLWDLAAGKTTRRFEDH 352
           DKT+++WD A G     FE H
Sbjct: 485 DKTIKVWDAATGVKRHTFEGH 505



 Score = 27.9 bits (59), Expect = 5.8
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K   T        T +A +P+  ++I     D T+ ++ +  DE      + +L GHS
Sbjct: 865  TFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDE-----VKSKLKGHS 919

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWD 313
              I+ +  S+  N  +S   D  L +W+
Sbjct: 920  KRITGLAFSNVLNVLVSSGADAQLCVWN 947


>At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4
           WD-40 repeats (PF00400);low similarity to
           photomorphogenesis repressor (COP1) GI:2702280
           [Arabidopsis thaliana] and COP1 GI:11127996 [Ipomoea
           nil]
          Length = 343

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 17/81 (20%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH+  +   + +   P+++ + S D     W +     +  + Q     H+  +  +  
Sbjct: 160 KGHDFELWTASFDLNNPNLVYTGSDDCKFSCWDIRDSPADNRVFQNSKV-HTMGVCCISS 218

Query: 254 SSDGNYAL-SGSWDKTLRLWD 313
           +    Y++ +GS+D+TLR+WD
Sbjct: 219 NPSDPYSIFTGSYDETLRVWD 239


>At3g15610.1 68416.m01980 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to serine/threonine kinase receptor associated
           protein GB:NP_035629 (SP:Q9Z1Z2) [Mus musculus];
           UNR-interacting protein GB:NP_009109 [Homo sapiens]
          Length = 341

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           GH+  V  +  +P  PD   ++S+S+D   +   L   E    I      GH   +    
Sbjct: 14  GHSRPVVDLFYSPITPDGFFLISASKDSQPM---LRNGETGDWIGT--FEGHKGAVWSSC 68

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           L ++   A S S D + +LWD   G     FE
Sbjct: 69  LDNNALRAASASADFSAKLWDALTGDVLHSFE 100


>At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40
            repeats domain (PF00400) (6 weak)
          Length = 1120

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K   T        T +A +P+  ++I     D T+ ++ +  DE      + +L GHS
Sbjct: 854  TFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDE-----VKSKLKGHS 908

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWD 313
              I+ +  S+  N  +S   D  L +W+
Sbjct: 909  KRITGLAFSNVLNVLVSSGADAQLCVWN 936



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 290 DKTLRLWDLAAGKTTRRFEDH 352
           DKT+++WD A G     FE H
Sbjct: 485 DKTIKVWDAATGVKRYTFEGH 505


>At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40
            repeats domain (PF00400) (6 weak)
          Length = 1120

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K   T        T +A +P+  ++I     D T+ ++ +  DE      + +L GHS
Sbjct: 854  TFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDE-----VKSKLKGHS 908

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWD 313
              I+ +  S+  N  +S   D  L +W+
Sbjct: 909  KRITGLAFSNVLNVLVSSGADAQLCVWN 936



 Score = 27.5 bits (58), Expect = 7.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 290 DKTLRLWDLAAGKTTRRFEDH 352
           DKT+++WD A G     FE H
Sbjct: 485 DKTIKVWDAATGVKRYTFEGH 505


>At4g03970.1 68417.m00561 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain; similar to  At5g28170, At1g35110,
           At1g44880, At3g42530, At4g19320, At5g36020, At3g43010,
           At2g10350
          Length = 1043

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +2

Query: 113 PKYPDMILSSSRDKTLIVWK-LTRDENNYGIPQ 208
           P   D++L  S  KT+++WK LT  +    +PQ
Sbjct: 220 PGLLDLVLDDSTSKTILLWKRLTHPKQVISLPQ 252


>At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pfam
           profile: PF00400 WD domain, G-beta repeat (7 copies)
          Length = 1135

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +2

Query: 290 DKTLRLWDLAAGKTTRRFEDH 352
           DKT+++WD   G     FE H
Sbjct: 487 DKTIKVWDAVTGNKLHTFEGH 507


>At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pfam
           profile: PF00400 WD domain, G-beta repeat (7 copies)
          Length = 1137

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +2

Query: 290 DKTLRLWDLAAGKTTRRFEDH 352
           DKT+++WD   G     FE H
Sbjct: 487 DKTIKVWDAVTGNKLHTFEGH 507


>At2g46340.1 68415.m05768 phytochrome A supressor spa1 (SPA1)
           identical to phytochrome A supressor spa1 (GI:4809171)
           [Arabidopsis thaliana]; contains 8 WD-40 repeats (Pfam
           PF00400) (1 weak)
          Length = 1029

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           NY  S  +D  +++WD   G+   ++ +H K
Sbjct: 779 NYLASTDYDGVVQIWDAGTGQGFSQYTEHQK 809


>At1g55680.1 68414.m06374 WD-40 repeat family protein contains 2 (1
           significant) WD-40 repeats (PF0400); similar to Trp-Asp
           repeat protein (PIR:T40094) [Schizosaccharomyces]
          Length = 445

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 15/42 (35%), Positives = 19/42 (45%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           N G     L GH  F        DG    +G+ DKT R+WD+
Sbjct: 305 NTGKTLATLSGHLDFSFASAWHPDGFTFSTGNQDKTCRVWDI 346


>At1g52730.2 68414.m05959 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to UNR-interacting protein (WD-40 repeat protein
           PT-WD) (SP:Q9Y3F4) [Homo sapiens]
          Length = 343

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           GH+  V  +  +P  PD   ++S+S+D   +   L   E    I      GH   +    
Sbjct: 14  GHSRPVVDLFYSPITPDGFFLISASKDSHPM---LRNGETGDWIGT--FEGHKGAVWSSC 68

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           L ++   A S S D + +LWD   G     FE
Sbjct: 69  LDNNALRAASASADFSAKLWDALTGDVLHSFE 100


>At1g52730.1 68414.m05958 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to UNR-interacting protein (WD-40 repeat protein
           PT-WD) (SP:Q9Y3F4) [Homo sapiens]
          Length = 343

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           GH+  V  +  +P  PD   ++S+S+D   +   L   E    I      GH   +    
Sbjct: 14  GHSRPVVDLFYSPITPDGFFLISASKDSHPM---LRNGETGDWIGT--FEGHKGAVWSSC 68

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           L ++   A S S D + +LWD   G     FE
Sbjct: 69  LDNNALRAASASADFSAKLWDALTGDVLHSFE 100


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,879,633
Number of Sequences: 28952
Number of extensions: 258902
Number of successful extensions: 1330
Number of sequences better than 10.0: 198
Number of HSP's better than 10.0 without gapping: 846
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1248
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1275599520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -