SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A08
         (614 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g31810.1 68414.m03904 formin homology 2 domain-containing pro...    31   0.46 
At3g16800.2 68416.m02145 protein phosphatase 2C, putative / PP2C...    30   1.1  
At3g16800.1 68416.m02146 protein phosphatase 2C, putative / PP2C...    30   1.1  
At2g06140.1 68415.m00675 hypothetical protein                          29   2.4  
At1g80420.2 68414.m09416 DNA repair protein, putative (XRCC1) id...    29   2.4  
At1g80420.1 68414.m09415 DNA repair protein, putative (XRCC1) id...    29   2.4  
At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar...    29   2.4  

>At1g31810.1 68414.m03904 formin homology 2 domain-containing
           protein / FH2 domain-containing protein low similarity
           to SP|P48608 Diaphanous protein {Drosophila
           melanogaster}; contains Pfam profile PF02181: Formin
           Homology 2(FH2) Domain
          Length = 1201

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKF--GDDILDLVVENADPRYPINLXDFMF 513
           LR YRQA+C  ++I  Q +  GD +L+ V  + DP   + +   MF
Sbjct: 232 LRHYRQAECDVIKIDIQCWVQGDVVLECVHMDLDPEREVMMFRVMF 277


>At3g16800.2 68416.m02145 protein phosphatase 2C, putative / PP2C,
           putative similar to protein phosphatase-2C GB:AAC36699
           from [Mesembryanthemum crystallinum]
          Length = 351

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = -3

Query: 453 KDIIAELLCTDFEEAALGLSVSPEIQSICSLWDRACPRCTKPLGIPRVRNPHID 292
           K   + LLC  +++    LS SPE  S   LW +AC +    + +    +P ID
Sbjct: 113 KSFPSSLLC-QWQQTLASLSSSPECSSPFDLWKQACLKTFSIIDLDLKISPSID 165


>At3g16800.1 68416.m02146 protein phosphatase 2C, putative / PP2C,
           putative similar to protein phosphatase-2C GB:AAC36699
           from [Mesembryanthemum crystallinum]
          Length = 351

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = -3

Query: 453 KDIIAELLCTDFEEAALGLSVSPEIQSICSLWDRACPRCTKPLGIPRVRNPHID 292
           K   + LLC  +++    LS SPE  S   LW +AC +    + +    +P ID
Sbjct: 113 KSFPSSLLC-QWQQTLASLSSSPECSSPFDLWKQACLKTFSIIDLDLKISPSID 165


>At2g06140.1 68415.m00675 hypothetical protein 
          Length = 633

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +3

Query: 240 ESINKTVKKDKDADNLLDQYEDYEPAEYQE 329
           ES+++ +  DK  DNL  + E +EP E +E
Sbjct: 588 ESLDRILDLDKKVDNLTTRIEGHEPMESEE 617


>At1g80420.2 68414.m09416 DNA repair protein, putative (XRCC1)
           identical to putative DNA repair protein XRCC1
           [Arabidopsis thaliana] GI:11181954; contains Pfam
           domain, PF00533: BRCA1 C Terminus (BRCT) domain
          Length = 353

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -3

Query: 459 EIKDIIAELLCTDFEEAALGLSVSPEIQSICSLWDRACPRCTKPLG 322
           EIK I AE + T  ++A   L    +I S+  LW    PR  K LG
Sbjct: 235 EIKRIAAEGVLTCLQDAIDSLEQKQDIGSVTELWS-FVPRVVKELG 279


>At1g80420.1 68414.m09415 DNA repair protein, putative (XRCC1)
           identical to putative DNA repair protein XRCC1
           [Arabidopsis thaliana] GI:11181954; contains Pfam
           domain, PF00533: BRCA1 C Terminus (BRCT) domain
          Length = 353

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -3

Query: 459 EIKDIIAELLCTDFEEAALGLSVSPEIQSICSLWDRACPRCTKPLG 322
           EIK I AE + T  ++A   L    +I S+  LW    PR  K LG
Sbjct: 235 EIKRIAAEGVLTCLQDAIDSLEQKQDIGSVTELWS-FVPRVVKELG 279


>At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar to
           receptor-like protein kinase (Ipomoea nil) (U77888)
          Length = 1029

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = +1

Query: 475 DPRYPINLXDFMFXKLGLHXVATVKIVNSTIGYIAP 582
           D      + DF   K+ LH   TV +V  + GYIAP
Sbjct: 863 DSNLEARIADFGLAKMMLHKNETVSMVAGSYGYIAP 898


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,531,957
Number of Sequences: 28952
Number of extensions: 248724
Number of successful extensions: 694
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 679
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 693
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1236350304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -