SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein...   113   6e-26
At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein...   113   6e-26
At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ...   112   2e-25
At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ...   112   2e-25
At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ...   112   2e-25
At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ...   111   4e-25
At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein...   101   3e-22
At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein...   101   5e-22
At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein...    99   1e-21
At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein...    99   1e-21
At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ...    97   6e-21
At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ...    97   1e-20
At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ...    97   1e-20
At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ...    95   3e-20
At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ...    83   1e-16
At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ...    82   2e-16
At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ...    80   9e-16
At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP...    79   2e-15
At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP...    79   2e-15
At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP...    79   2e-15
At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ...    79   2e-15
At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ...    78   4e-15
At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ...    78   5e-15
At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ...    78   5e-15
At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)...    75   4e-14
At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)...    74   6e-14
At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ...    74   6e-14
At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ...    74   6e-14
At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ...    74   6e-14
At5g61030.1 68418.m07659 RNA-binding protein, putative similar t...    73   1e-13
At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP...    73   1e-13
At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ...    73   1e-13
At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ...    73   1e-13
At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ...    73   1e-13
At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ...    73   1e-13
At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat...    73   2e-13
At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat...    73   2e-13
At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to...    73   2e-13
At5g04280.1 68418.m00421 glycine-rich RNA-binding protein              72   2e-13
At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)...    71   4e-13
At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)...    71   4e-13
At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ...    70   1e-12
At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila...    70   1e-12
At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat...    70   1e-12
At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat...    70   1e-12
At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat...    69   2e-12
At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila...    69   3e-12
At5g06210.1 68418.m00693 RNA-binding protein, putative contains ...    67   9e-12
At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein...    66   1e-11
At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat...    66   2e-11
At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ...    64   5e-11
At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ...    64   7e-11
At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ...    62   4e-10
At2g37510.1 68415.m04600 RNA-binding protein, putative similar t...    61   5e-10
At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ...    61   6e-10
At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ...    61   6e-10
At3g08000.1 68416.m00977 RNA-binding protein, putative similar t...    61   6e-10
At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ...    60   1e-09
At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ...    60   1e-09
At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat...    57   8e-09
At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea...    56   1e-08
At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea...    56   1e-08
At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ...    56   2e-08
At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide...    56   2e-08
At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide...    56   2e-08
At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide...    56   2e-08
At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /...    55   3e-08
At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /...    55   3e-08
At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ...    55   3e-08
At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ...    54   7e-08
At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ...    53   2e-07
At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)...    52   2e-07
At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria...    52   4e-07
At5g51300.2 68418.m06360 splicing factor-related contains simila...    51   5e-07
At5g51300.1 68418.m06359 splicing factor-related contains simila...    51   5e-07
At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ...    51   5e-07
At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ...    51   7e-07
At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ...    50   9e-07
At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ...    50   9e-07
At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ...    50   1e-06
At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi...    50   1e-06
At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ...    50   1e-06
At2g21690.1 68415.m02580 RNA-binding protein, putative similar t...    50   2e-06
At3g46020.1 68416.m04979 RNA-binding protein, putative similar t...    49   3e-06
At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ...    48   4e-06
At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3...    48   5e-06
At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ...    48   5e-06
At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ...    48   6e-06
At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k...    48   6e-06
At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC...    47   8e-06
At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC...    47   8e-06
At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ...    47   1e-05
At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)...    47   1e-05
At4g16280.3 68417.m02471 flowering time control protein / FCA ga...    47   1e-05
At4g16280.2 68417.m02470 flowering time control protein / FCA ga...    47   1e-05
At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ...    47   1e-05
At1g49760.1 68414.m05580 polyadenylate-binding protein, putative...    46   1e-05
At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ...    46   2e-05
At2g36660.1 68415.m04496 polyadenylate-binding protein, putative...    46   2e-05
At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ...    46   2e-05
At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ...    46   2e-05
At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative      45   4e-05
At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ...    44   6e-05
At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro...    44   6e-05
At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3)       44   6e-05
At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ...    44   6e-05
At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ...    44   6e-05
At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ...    44   8e-05
At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ...    44   8e-05
At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ...    44   8e-05
At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu...    44   8e-05
At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ...    44   1e-04
At3g16380.1 68416.m02074 polyadenylate-binding protein, putative...    44   1e-04
At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ...    44   1e-04
At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ...    44   1e-04
At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ...    43   1e-04
At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ...    43   1e-04
At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ...    43   1e-04
At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id...    43   1e-04
At2g23350.1 68415.m02788 polyadenylate-binding protein, putative...    43   1e-04
At3g19130.1 68416.m02429 RNA-binding protein, putative similar t...    43   2e-04
At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33...    43   2e-04
At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ...    42   3e-04
At1g34140.1 68414.m04235 polyadenylate-binding protein, putative...    42   3e-04
At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu...    42   3e-04
At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi...    42   4e-04
At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ...    42   4e-04
At4g03110.2 68417.m00421 RNA-binding protein, putative similar t...    42   4e-04
At4g03110.1 68417.m00420 RNA-binding protein, putative similar t...    42   4e-04
At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ...    42   4e-04
At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein...    41   5e-04
At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit...    41   7e-04
At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit...    41   7e-04
At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit...    41   7e-04
At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ...    41   7e-04
At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit...    41   7e-04
At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ...    40   0.001
At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (...    40   0.001
At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu...    40   0.001
At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu...    40   0.001
At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30...    40   0.001
At5g41690.1 68418.m05067 polyadenylate-binding protein, putative...    39   0.002
At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ...    39   0.002
At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ...    39   0.002
At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ...    39   0.002
At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa...    39   0.003
At1g71800.1 68414.m08298 cleavage stimulation factor, putative s...    39   0.003
At5g03580.1 68418.m00316 polyadenylate-binding protein, putative...    38   0.004
At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ...    38   0.004
At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ...    38   0.004
At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ...    38   0.004
At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi...    38   0.005
At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) famil...    38   0.005
At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ...    37   0.009
At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ...    37   0.009
At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ...    37   0.009
At1g03457.1 68414.m00326 RNA-binding protein, putative similar t...    37   0.009
At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ...    37   0.011
At5g06000.1 68418.m00665 eukaryotic translation initiation facto...    36   0.020
At3g11400.1 68416.m01390 eukaryotic translation initiation facto...    36   0.020
At1g03457.2 68414.m00327 RNA-binding protein, putative similar t...    36   0.020
At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS...    36   0.026
At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ...    35   0.035
At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ...    35   0.046
At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu...    35   0.046
At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28...    34   0.061
At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ...    34   0.081
At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ...    34   0.081
At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ...    34   0.081
At3g14450.1 68416.m01831 RNA-binding protein, putative contains ...    33   0.11 
At2g05160.1 68415.m00543 zinc finger (CCCH-type) family protein ...    33   0.11 
At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s...    33   0.14 
At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing ...    33   0.14 
At2g47310.1 68415.m05906 flowering time control protein-related ...    33   0.14 
At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing ...    33   0.19 
At1g53650.1 68414.m06105 RNA-binding protein, putative similar t...    33   0.19 
At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ...    32   0.33 
At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-bindi...    32   0.33 
At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ...    31   0.43 
At3g01150.1 68416.m00019 polypyrimidine tract-binding protein, p...    31   0.43 
At1g51520.2 68414.m05799 expressed protein contains a weak hit t...    30   1.00 
At1g51520.1 68414.m05798 expressed protein contains a weak hit t...    30   1.00 
At3g50670.2 68416.m05543 U1 small nuclear ribonucleoprotein 70 (...    30   1.3  
At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing ...    29   2.3  
At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ...    29   3.0  
At4g10610.1 68417.m01735 RNA-binding protein, putative                 29   3.0  
At1g72800.1 68414.m08416 nuM1-related contains similarity with n...    29   3.0  
At4g34040.1 68417.m04830 zinc finger (C3HC4-type RING finger) fa...    28   4.0  
At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p...    28   4.0  
At1g05890.1 68414.m00617 zinc finger protein-related contains lo...    28   4.0  
At5g20870.1 68418.m02478 glycosyl hydrolase family 17 protein si...    28   5.3  
At5g13620.1 68418.m01578 expressed protein ; expression supporte...    28   5.3  
At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ...    28   5.3  
At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ...    28   5.3  
At1g32790.1 68414.m04042 RNA-binding protein, putative similar t...    28   5.3  
At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)...    28   5.3  
At5g59950.3 68418.m07518 RNA and export factor-binding protein, ...    27   7.0  
At5g59950.2 68418.m07519 RNA and export factor-binding protein, ...    27   7.0  
At5g59950.1 68418.m07517 RNA and export factor-binding protein, ...    27   7.0  
At5g54210.1 68418.m06753 NLI interacting factor (NIF) family pro...    27   7.0  
At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ...    27   7.0  
At4g35030.1 68417.m04969 protein kinase family protein contains ...    27   7.0  
At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR...    27   7.0  
At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR...    27   7.0  
At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containi...    27   7.0  
At5g24440.1 68418.m02880 RNA-binding protein, putative                 27   9.3  
At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ...    27   9.3  
At1g19600.1 68414.m02441 pfkB-type carbohydrate kinase family pr...    27   9.3  
At1g04130.1 68414.m00402 tetratricopeptide repeat (TPR)-containi...    27   9.3  

>At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative contains Pfam profile:
           PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 495

 Score =  113 bits (273), Expect = 6e-26
 Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 13/126 (10%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GKLF+GG+SW+T++E L+ YFS +GEVI+ V++K+  +GR+RGFGFV FADP++  +V
Sbjct: 4   DNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIV 63

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQ-------------KPKRGGGYPKVFLGGLPSNVTET 400
           +    H +DGR ++ K   PR  Q              P   G   K+F+GGLPS+VTE+
Sbjct: 64  ITE-KHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTES 122

Query: 401 DLRXIF 418
           D +  F
Sbjct: 123 DFKTYF 128



 Score = 65.3 bits (152), Expect = 3e-11
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 4/93 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++ + + YF ++G   D VVM +  + R RGFGF+T+     V  VL  
Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLK 168

Query: 269 GPHQLDGRTIDPKPCNPRTLQK-PKR---GGGY 355
             H+L+G+ ++ K   P+ L   P R   G GY
Sbjct: 169 TFHELNGKMVEVKRAVPKELSPGPSRSPLGAGY 201



 Score = 35.1 bits (77), Expect = 0.035
 Identities = 13/45 (28%), Positives = 27/45 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G   +VV+MYD   ++  G GF++++ E +  +   +T H
Sbjct: 127 YFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFH 171


>At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative contains Pfam profile:
           PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 494

 Score =  113 bits (273), Expect = 6e-26
 Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 13/126 (10%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GKLF+GG+SW+T++E L+ YFS +GEVI+ V++K+  +GR+RGFGFV FADP++  +V
Sbjct: 4   DNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIV 63

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQ-------------KPKRGGGYPKVFLGGLPSNVTET 400
           +    H +DGR ++ K   PR  Q              P   G   K+F+GGLPS+VTE+
Sbjct: 64  ITE-KHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTES 122

Query: 401 DLRXIF 418
           D +  F
Sbjct: 123 DFKTYF 128



 Score = 65.3 bits (152), Expect = 3e-11
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 4/93 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++ + + YF ++G   D VVM +  + R RGFGF+T+     V  VL  
Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLK 168

Query: 269 GPHQLDGRTIDPKPCNPRTLQK-PKR---GGGY 355
             H+L+G+ ++ K   P+ L   P R   G GY
Sbjct: 169 TFHELNGKMVEVKRAVPKELSPGPSRSPLGAGY 201



 Score = 35.1 bits (77), Expect = 0.035
 Identities = 13/45 (28%), Positives = 27/45 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G   +VV+MYD   ++  G GF++++ E +  +   +T H
Sbjct: 127 YFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFH 171


>At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing
           protein similar to DAZ associated protein 1 [Homo
           sapiens] GI:8671754; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 460

 Score =  112 bits (269), Expect = 2e-25
 Identities = 54/130 (41%), Positives = 82/130 (63%), Gaps = 15/130 (11%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + + GKLF+GG+SW+T +E L+ YFS YG+V++ V+M++  +GR+RGFGF+ FADP +  
Sbjct: 2   ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSE 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRT-------------LQKPKRGGG--YPKVFLGGLPSN 388
            V+ +  H +DGRT++ K   PR              L  P  GGG    K+F+GGLPS+
Sbjct: 62  RVIMD-KHIIDGRTVEAKKAVPRDDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSS 120

Query: 389 VTETDLRXIF 418
           +TE + +  F
Sbjct: 121 ITEEEFKNYF 130



 Score = 68.1 bits (159), Expect = 4e-12
 Identities = 30/80 (37%), Positives = 48/80 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++E  + YF ++G + D VVM +  + R RGFGF+TF     V+ VL  
Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHK 170

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ +
Sbjct: 171 TFHELNGKLVEVKRAVPKEI 190



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF++F+ + +  +   +T H
Sbjct: 129 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFH 173



 Score = 34.3 bits (75), Expect = 0.061
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YG V+E VIM D+   ++ G GF+ F D
Sbjct: 25  YFSNYGDVVEAVIMRDRATGRARGFGFIVFAD 56


>At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing
           protein similar to DAZ associated protein 1 [Homo
           sapiens] GI:8671754; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 460

 Score =  112 bits (269), Expect = 2e-25
 Identities = 54/130 (41%), Positives = 82/130 (63%), Gaps = 15/130 (11%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + + GKLF+GG+SW+T +E L+ YFS YG+V++ V+M++  +GR+RGFGF+ FADP +  
Sbjct: 2   ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSE 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRT-------------LQKPKRGGG--YPKVFLGGLPSN 388
            V+ +  H +DGRT++ K   PR              L  P  GGG    K+F+GGLPS+
Sbjct: 62  RVIMD-KHIIDGRTVEAKKAVPRDDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSS 120

Query: 389 VTETDLRXIF 418
           +TE + +  F
Sbjct: 121 ITEEEFKNYF 130



 Score = 68.1 bits (159), Expect = 4e-12
 Identities = 30/80 (37%), Positives = 48/80 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++E  + YF ++G + D VVM +  + R RGFGF+TF     V+ VL  
Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHK 170

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ +
Sbjct: 171 TFHELNGKLVEVKRAVPKEI 190



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF++F+ + +  +   +T H
Sbjct: 129 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFH 173



 Score = 34.3 bits (75), Expect = 0.061
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YG V+E VIM D+   ++ G GF+ F D
Sbjct: 25  YFSNYGDVVEAVIMRDRATGRARGFGFIVFAD 56


>At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing
           protein similar to DAZ associated protein 1 [Homo
           sapiens] GI:8671754; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 448

 Score =  112 bits (269), Expect = 2e-25
 Identities = 54/130 (41%), Positives = 82/130 (63%), Gaps = 15/130 (11%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + + GKLF+GG+SW+T +E L+ YFS YG+V++ V+M++  +GR+RGFGF+ FADP +  
Sbjct: 2   ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSE 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRT-------------LQKPKRGGG--YPKVFLGGLPSN 388
            V+ +  H +DGRT++ K   PR              L  P  GGG    K+F+GGLPS+
Sbjct: 62  RVIMD-KHIIDGRTVEAKKAVPRDDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSS 120

Query: 389 VTETDLRXIF 418
           +TE + +  F
Sbjct: 121 ITEEEFKNYF 130



 Score = 68.1 bits (159), Expect = 4e-12
 Identities = 30/80 (37%), Positives = 48/80 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++E  + YF ++G + D VVM +  + R RGFGF+TF     V+ VL  
Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHK 170

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ +
Sbjct: 171 TFHELNGKLVEVKRAVPKEI 190



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF++F+ + +  +   +T H
Sbjct: 129 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFH 173



 Score = 34.3 bits (75), Expect = 0.061
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YG V+E VIM D+   ++ G GF+ F D
Sbjct: 25  YFSNYGDVVEAVIMRDRATGRARGFGFIVFAD 56


>At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 455

 Score =  111 bits (266), Expect = 4e-25
 Identities = 57/143 (39%), Positives = 86/143 (60%), Gaps = 22/143 (15%)
 Frame = +2

Query: 56  MNPDMDDDEK----GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           MNP+    E     GKLF+GG+SW+T +E LQ YF +YG++++ V+M++  +GR+RGFGF
Sbjct: 1   MNPEEQKMESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGF 60

Query: 224 VTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQK-------------PKRGGG---- 352
           + FADPS+   V+ +  H +DGRT++ K   PR  Q+             P  GG     
Sbjct: 61  IVFADPSVAERVIMD-KHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPSHGGNGGGA 119

Query: 353 -YPKVFLGGLPSNVTETDLRXIF 418
              K+F+GGLPS++TE + +  F
Sbjct: 120 RTKKIFVGGLPSSITEAEFKNYF 142



 Score = 67.7 bits (158), Expect = 5e-12
 Identities = 30/80 (37%), Positives = 48/80 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++   + YF ++G + D VVM +  + R RGFGF+TF     V++VL  
Sbjct: 123 KIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHK 182

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ L
Sbjct: 183 TFHELNGKMVEVKRAVPKEL 202



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF++F+ E S      +T H
Sbjct: 141 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFH 185



 Score = 36.3 bits (80), Expect = 0.015
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +FG+YG ++E VIM D+   ++ G GF+ F D
Sbjct: 34  YFGKYGDLVEAVIMRDRTTGRARGFGFIVFAD 65


>At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative 
          Length = 404

 Score =  101 bits (243), Expect = 3e-22
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 15/132 (11%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + ++GKLF+GG+SW+T +  L+ YFS +GEV+   VM+   +GR RGFGFV F+DP++++
Sbjct: 2   ESDQGKLFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVID 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGGY--------------PKVFLGGLPSN 388
            VLQ+  H +D R +D K    R  Q P  R G +               K+F+GGLP  
Sbjct: 62  RVLQD-KHHIDNRDVDVKRAMSREEQSPAGRSGTFNASRNFDSGANVRTKKIFVGGLPPA 120

Query: 389 VTETDLRXIFRT 424
           +T  + R  F T
Sbjct: 121 LTSDEFRAYFET 132



 Score = 68.1 bits (159), Expect = 4e-12
 Identities = 37/99 (37%), Positives = 51/99 (51%), Gaps = 1/99 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    + +  + YF  YG V D V+M +  + R RGFGFV+F     V+LVL  
Sbjct: 111 KIFVGGLPPALTSDEFRAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHK 170

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP-KRGGGYPKVFLGGLP 382
             H L+G+ ++ K   P+        GGG      GG P
Sbjct: 171 TFHDLNGKQVEVKRALPKDANPGIASGGGRGSGGAGGFP 209



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 16/35 (45%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F  YG V + VIM DQ  ++  G GF+SF+ E S
Sbjct: 129 YFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDS 163



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 10/32 (31%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  +G+V++V +M ++   +  G GF++F D
Sbjct: 25  YFSNFGEVLQVTVMREKATGRPRGFGFVAFSD 56


>At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative 
          Length = 411

 Score =  101 bits (241), Expect = 5e-22
 Identities = 53/130 (40%), Positives = 77/130 (59%), Gaps = 15/130 (11%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D ++GKLFVGG+SWET ++ L+ +F+ YGEV   +VM++  +GR RGFGFV F+DPS+++
Sbjct: 2   DSDQGKLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLD 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPR----------TLQKPKRGGG-----YPKVFLGGLPSN 388
            VLQ   H +D R +D K    R           L   +  GG       K+F+GGLP  
Sbjct: 62  RVLQE-KHSIDTREVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPT 120

Query: 389 VTETDLRXIF 418
           +T+ + R  F
Sbjct: 121 LTDEEFRQYF 130



 Score = 64.9 bits (151), Expect = 4e-11
 Identities = 35/93 (37%), Positives = 48/93 (51%), Gaps = 5/93 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    + E  ++YF  YG V D  +M +  + R RGFGFV+F     V+ VL  
Sbjct: 111 KIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHK 170

Query: 269 GPHQLDGRTID-----PKPCNPRTLQKPKRGGG 352
             H L G+ ++     PK  NP    +   GGG
Sbjct: 171 TFHDLSGKQVEVKRALPKDANPGGGGRSMGGGG 203



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 22/65 (33%), Positives = 31/65 (47%)
 Frame = +3

Query: 354 TLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSD 533
           T +  + G   TL       +F  YG V +V IMYDQ   +  G GF+SF+ E +     
Sbjct: 109 TKKIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVL 168

Query: 534 PRTLH 548
            +T H
Sbjct: 169 HKTFH 173



 Score = 29.5 bits (63), Expect = 1.7
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F  YG+V + ++M D+   +  G GF+ F D
Sbjct: 26  FTNYGEVSQAIVMRDKLTGRPRGFGFVIFSD 56


>At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative
          Length = 431

 Score =   99 bits (238), Expect = 1e-21
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 11/124 (8%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  KLF+GG+SWETS++ L+ YF  +GEV++ V+MK+  +GR+RGFGFV FADP++   V
Sbjct: 4   ESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERV 63

Query: 260 LQNGPHQLDGRTIDPKPCNPR-----------TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
           +    H +DG+ ++ K   PR           +LQ         K+F+GGL S+VTE + 
Sbjct: 64  VLL-KHIIDGKIVEAKKAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEF 122

Query: 407 RXIF 418
           +  F
Sbjct: 123 KKYF 126



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 28/80 (35%), Positives = 51/80 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+   ++   ++YF+++G + D VVM +  + R RGFGF+++     V+ VLQ 
Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQK 166

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ +
Sbjct: 167 TFHELNGKMVEVKLAVPKDM 186



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 14/45 (31%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF+S++ E +  +   +T H
Sbjct: 125 YFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFH 169



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  +G+V+E VIM D+   ++ G GF+ F D
Sbjct: 25  YFHSFGEVLEAVIMKDRATGRARGFGFVVFAD 56


>At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative
          Length = 431

 Score =   99 bits (238), Expect = 1e-21
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 11/124 (8%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  KLF+GG+SWETS++ L+ YF  +GEV++ V+MK+  +GR+RGFGFV FADP++   V
Sbjct: 4   ESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERV 63

Query: 260 LQNGPHQLDGRTIDPKPCNPR-----------TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
           +    H +DG+ ++ K   PR           +LQ         K+F+GGL S+VTE + 
Sbjct: 64  VLL-KHIIDGKIVEAKKAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEF 122

Query: 407 RXIF 418
           +  F
Sbjct: 123 KKYF 126



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 28/80 (35%), Positives = 51/80 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+   ++   ++YF+++G + D VVM +  + R RGFGF+++     V+ VLQ 
Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQK 166

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ +
Sbjct: 167 TFHELNGKMVEVKLAVPKDM 186



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 14/45 (31%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF+S++ E +  +   +T H
Sbjct: 125 YFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFH 169



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  +G+V+E VIM D+   ++ G GF+ F D
Sbjct: 25  YFHSFGEVLEAVIMKDRATGRARGFGFVVFAD 56


>At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing
           protein similar to GB:L02953 from [Xenopus laevis]
           (Nucleic Acids Res. 21, 999-1006 (1993)); contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 369

 Score = 97.5 bits (232), Expect = 6e-21
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 2/113 (1%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           GKLFVGG+SWET+ E    YF ++GEV+D V+M +  +G  RGFGFVTFAD ++   VL+
Sbjct: 66  GKLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLE 125

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKP--KRGGGYPKVFLGGLPSNVTETDLRXIF 418
              H +D R +D K   PR  +    K      K+F+GGLP  + E +L+  F
Sbjct: 126 E-DHVIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYF 177



 Score = 63.7 bits (148), Expect = 9e-11
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 1/79 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL     ++ L+ YF  YG++I+  +M +  +GRSRGFGFVTF     V+ +  +
Sbjct: 158 KIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSD 217

Query: 269 GP-HQLDGRTIDPKPCNPR 322
           G  H+L  + ++ K   P+
Sbjct: 218 GKVHELGDKQVEIKRAEPK 236



 Score = 34.7 bits (76), Expect = 0.046
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F  YG ++E  IMYD    +S G GF++F+ E S
Sbjct: 176 YFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDS 210



 Score = 33.9 bits (74), Expect = 0.081
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +FG++G+V++ VIM D+      G GF++F D
Sbjct: 85  YFGKFGEVVDSVIMTDRITGNPRGFGFVTFAD 116


>At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 358

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 44/117 (37%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D    GK+F+GGL  +T+     ++F +YGE+ D V+M++  +G+ RGFGF+TFADPS+V
Sbjct: 14  DGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVV 73

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           + V+++  H ++G+ ++ K   P+       +     K+F+GG+PS VTE +L+  F
Sbjct: 74  DKVIED-THVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129



 Score = 58.8 bits (136), Expect = 2e-09
 Identities = 30/99 (30%), Positives = 56/99 (56%), Gaps = 3/99 (3%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVGG+    +++ L+ +F++YG V++  V+++ E+ RSRGFGFV F    +V+
Sbjct: 105 DIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVD 164

Query: 254 LVLQNGPH-QLDGRTIDPKPCNPRTL--QKPKRGGGYPK 361
            +L  G    +    ++ K   P+    + P   G +P+
Sbjct: 165 ELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSYGSHPR 203



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           + G H+     +    FG+YG++ + VIM D+   +  G GF++F D
Sbjct: 23  IGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFAD 69



 Score = 36.3 bits (80), Expect = 0.015
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +3

Query: 333 NRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           N++  + T +  + G   T+ +     FF +YG V+E  ++ D    +S G GF+ F+ E
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSE 160


>At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 231

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 44/117 (37%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D    GK+F+GGL  +T+     ++F +YGE+ D V+M++  +G+ RGFGF+TFADPS+V
Sbjct: 14  DGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVV 73

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           + V+++  H ++G+ ++ K   P+       +     K+F+GG+PS VTE +L+  F
Sbjct: 74  DKVIED-THVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129



 Score = 58.4 bits (135), Expect = 3e-09
 Identities = 25/66 (37%), Positives = 44/66 (66%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVGG+    +++ L+ +F++YG V++  V+++ E+ RSRGFGFV F    +V+
Sbjct: 105 DIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVD 164

Query: 254 LVLQNG 271
            +L  G
Sbjct: 165 ELLSKG 170



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           + G H+     +    FG+YG++ + VIM D+   +  G GF++F D
Sbjct: 23  IGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFAD 69



 Score = 36.3 bits (80), Expect = 0.015
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +3

Query: 333 NRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           N++  + T +  + G   T+ +     FF +YG V+E  ++ D    +S G GF+ F+ E
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSE 160


>At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing
           protein ribonucleoprotein, Xenopus laevis, PIR:S40778;
           contains InterPro entry IPR000504: RNA-binding region
           RNP-1 (RNA recognition motif) (RRM)
          Length = 423

 Score = 95.1 bits (226), Expect = 3e-20
 Identities = 46/119 (38%), Positives = 74/119 (62%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D  GK+FVGGL+ ET+     ++F +YGE+ D V+MK+ ++G+ RGFGFVT+AD S+V+ 
Sbjct: 39  DSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDK 98

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
           V+Q+  H + G+ ++ K   PR            K+F+GG+PS+V + + +  F    E
Sbjct: 99  VIQDN-HIIIGKQVEIKRTIPRG-SMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGE 155



 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 32/106 (30%), Positives = 58/106 (54%), Gaps = 4/106 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D +  K+FVGG+      +  + +F ++GE+ +  +M++  +GRSRGFGFVT+    +V
Sbjct: 125 NDFKTKKIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMV 184

Query: 251 NLVLQNGPH-QLDGRTIDPK---PCNPRTLQKPKRGGGYPKVFLGG 376
           + +L  G   +L G  ++ K   P  P ++  P +  G  +   GG
Sbjct: 185 DHLLAKGNRIELSGTQVEIKKAEPKKPNSVTTPSKRFGDSRSNFGG 230



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FG+YG++ + VIM D+   +  G GF+++ D
Sbjct: 62  FGKYGEITDSVIMKDRKTGQPRGFGFVTYAD 92


>At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing
           protein similar to SP|P48809 Heterogeneous nuclear
           ribonucleoprotein 27C (hnRNP 48) {Drosophila
           melanogaster}; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM);
           non-consensus TA donor splice site at exon 6
          Length = 379

 Score = 83.0 bits (196), Expect = 1e-16
 Identities = 42/116 (36%), Positives = 69/116 (59%), Gaps = 1/116 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL V G+ W+   + L+ Y S++G++ DC+VMK+  +GRSRGFG+VTFA        L+ 
Sbjct: 4   KLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALK- 62

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
           G H L  R ++ K   P+  +++P +     ++F+  +PS+V+E+D R  F    E
Sbjct: 63  GEHFLGNRILEVKVATPKEEMRQPAK--KVTRIFVARIPSSVSESDFRSHFERYGE 116



 Score = 57.2 bits (132), Expect = 8e-09
 Identities = 29/86 (33%), Positives = 46/86 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L  E S ++L+ YF R+G + D  + K+ +    RGFGFVTFA+  + + V + 
Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVARR 300

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRG 346
             H++ G+ +      P     P  G
Sbjct: 301 S-HEICGQEVAIDSATPLDEAGPSAG 325



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 25/85 (29%), Positives = 44/85 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FV  +    S+ + + +F RYGE+ D  + K+  S + RG GF+TF+    V  ++++
Sbjct: 92  RIFVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLMED 151

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKR 343
             H L G T+      P+    P R
Sbjct: 152 -THDLGGTTVAVDRATPKEDDHPPR 175



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F RYG++ ++ +  D   K+  G GF++F    S
Sbjct: 111 FERYGEITDLYMPKDYNSKQHRGIGFITFSSADS 144



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +FGR+G + +  I  D  +    G GF++F +
Sbjct: 259 YFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAE 290


>At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing
           protein low similarity to RRM-containing protein SEB-4
           [Xenopus laevis] GI:8895698; contains Pfam profile:
           PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 285

 Score = 82.2 bits (194), Expect = 2e-16
 Identities = 37/95 (38%), Positives = 58/95 (61%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +N    D    K+FVGGL+WET  E L+++F +YGE+++ VV+ +  +GRS+G+GFVTF 
Sbjct: 14  LNSPFGDTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFR 73

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
           DP        +    +DGR  +   CN  +L +P+
Sbjct: 74  DPEAARRACADPTPIIDGRRAN---CNLASLGRPR 105



 Score = 33.9 bits (74), Expect = 0.081
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG+++E V++ D+   +S G GF++F D
Sbjct: 44  FEQYGEILEAVVIADKNTGRSKGYGFVTFRD 74


>At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 304

 Score = 80.2 bits (189), Expect = 9e-16
 Identities = 38/96 (39%), Positives = 60/96 (62%), Gaps = 2/96 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N +  D +  K+FVGGL+WET ++ ++RYF ++GE+++ VV+ +  +GRS+G+GFVTF +
Sbjct: 13  NNNTTDTKLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKE 72

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTL--QKPK 340
                   QN    +DGR  +   CN   L  QKP+
Sbjct: 73  AEAAMRACQNMNPVIDGRRAN---CNLACLGAQKPR 105


>At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 92

 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 37/88 (42%), Positives = 56/88 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           + FVGGL+W T+ E+LQR FS++G+VID  ++ + ESGRSRGFGFVTF D       +++
Sbjct: 7   RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEK----AMRD 62

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
              +++G+ +D +       Q    GGG
Sbjct: 63  AIEEMNGKELDGRVITVNEAQSRGSGGG 90



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F ++G V++  I+ D+   +S G GF++F+DE
Sbjct: 26  FSQFGDVIDSKIINDRESGRSRGFGFVTFKDE 57


>At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 126

 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 37/88 (42%), Positives = 56/88 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           + FVGGL+W T+ E+LQR FS++G+VID  ++ + ESGRSRGFGFVTF D       +++
Sbjct: 7   RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEK----AMRD 62

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
              +++G+ +D +       Q    GGG
Sbjct: 63  AIEEMNGKELDGRVITVNEAQSRGSGGG 90



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F ++G V++  I+ D+   +S G GF++F+DE
Sbjct: 26  FSQFGDVIDSKIINDRESGRSRGFGFVTFKDE 57


>At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 169

 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 37/88 (42%), Positives = 56/88 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           + FVGGL+W T+ E+LQR FS++G+VID  ++ + ESGRSRGFGFVTF D       +++
Sbjct: 7   RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEK----AMRD 62

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
              +++G+ +D +       Q    GGG
Sbjct: 63  AIEEMNGKELDGRVITVNEAQSRGSGGG 90



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F ++G V++  I+ D+   +S G GF++F+DE
Sbjct: 26  FSQFGDVIDSKIINDRESGRSRGFGFVTFKDE 57


>At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing
           protein similar to RRM-containing protein SEB-4 [Xenopus
           laevis] GI:8895698; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM);
           is the location of EST 197B1T7 , gb|AA597386
          Length = 274

 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +N    D    K+FVGGL+WET  E L+R+F +YG++++ VV+ +  +GRS+G+GFVTF 
Sbjct: 14  LNSPFGDTTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFR 73

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
           DP        +    +DGR  +   CN  +L + +
Sbjct: 74  DPEAARRACVDPTPIIDGRRAN---CNLASLGRSR 105



 Score = 33.5 bits (73), Expect = 0.11
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG ++E V++ D+   +S G GF++F D
Sbjct: 44  FDQYGDILEAVVITDKNTGRSKGYGFVTFRD 74


>At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 146

 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 40/114 (35%), Positives = 66/114 (57%), Gaps = 7/114 (6%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    K+FVGGL+WET  + ++RYF ++GE+++ V++ +  +G+S+G+GFVTF D     
Sbjct: 13  DTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSAT 72

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPK----RG---GGYPKVFLGGLPSNVT 394
             + +    +DGR  +   CN  +  +P+    RG   GG P  + GG  S+ T
Sbjct: 73  RAVADPNPVIDGRKAN---CNIASFGRPRPSTPRGRGQGGSPSQYQGGGQSSYT 123



 Score = 36.7 bits (81), Expect = 0.011
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+++E VI+ D+   KS G GF++F D  S
Sbjct: 36  YFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDS 70


>At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing
           protein similar to RRM-containing protein SEB-4 [Xenopus
           laevis] GI:8895698; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 244

 Score = 77.8 bits (183), Expect = 5e-15
 Identities = 32/75 (42%), Positives = 50/75 (66%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M+D    K+FVGGL+WET + +L+ YF ++G++++ VV+ +  SGRS+G+GFVTF DP  
Sbjct: 1   MEDTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEA 60

Query: 248 VNLVLQNGPHQLDGR 292
                 +    +DGR
Sbjct: 61  AQKACVDPAPVIDGR 75


>At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing
           protein similar to RRM-containing protein SEB-4 [Xenopus
           laevis] GI:8895698; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 245

 Score = 77.8 bits (183), Expect = 5e-15
 Identities = 32/75 (42%), Positives = 50/75 (66%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M+D    K+FVGGL+WET + +L+ YF ++G++++ VV+ +  SGRS+G+GFVTF DP  
Sbjct: 1   MEDTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEA 60

Query: 248 VNLVLQNGPHQLDGR 292
                 +    +DGR
Sbjct: 61  AQKACVDPAPVIDGR 75


>At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)
           glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis
           thaliana] GI:2826811
          Length = 153

 Score = 74.9 bits (176), Expect = 4e-14
 Identities = 39/97 (40%), Positives = 54/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-Q 265
           KLF+GGLSW T   +L+  F+ +G+V+D  V+ + E+GRSRGFGFV F D       + +
Sbjct: 36  KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISE 95

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
               +L+GR I   P N R       GGG    + GG
Sbjct: 96  MDGKELNGRHIRVNPANDRPSAPRAYGGGGGYSYGGG 132



 Score = 30.7 bits (66), Expect = 0.75
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  +G V++  ++ D+   +S G GF++F DE
Sbjct: 55  FAHFGDVVDAKVIVDRETGRSRGFGFVNFNDE 86


>At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)
           glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis
           thaliana] GI:2826811
          Length = 158

 Score = 74.1 bits (174), Expect = 6e-14
 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-Q 265
           KLF+GGLSW T   +L+  F+ +G+V+D  V+ + E+GRSRGFGFV F D       + +
Sbjct: 36  KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISE 95

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
               +L+GR I   P N R       GGG
Sbjct: 96  MDGKELNGRHIRVNPANDRPSAPRAYGGG 124



 Score = 30.7 bits (66), Expect = 0.75
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  +G V++  ++ D+   +S G GF++F DE
Sbjct: 55  FAHFGDVVDAKVIVDRETGRSRGFGFVNFNDE 86


>At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 272

 Score = 74.1 bits (174), Expect = 6e-14
 Identities = 32/74 (43%), Positives = 48/74 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    K+FVG L+W T+ ++L+RYF ++G+V+D  V+  +  GRS+G+GF+TF D     
Sbjct: 8   DTRVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTV 67

Query: 254 LVLQNGPHQLDGRT 295
             LQN    +DGRT
Sbjct: 68  RALQNSKPIIDGRT 81



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  ++ +    +S G GF++F D  S
Sbjct: 31  YFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVS 65


>At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing
           protein similar to RNA recognition motif-containing
           protein SEB-4 GI:8895698 from [Xenopus laevis]; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 271

 Score = 74.1 bits (174), Expect = 6e-14
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  + ++RYF ++GE+++ V++ +  +G+S+G+GFVTF +       + +
Sbjct: 18  KVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVAD 77

Query: 269 GPHQLDGRTIDPKPCN-PRTLQKPKRGGGY---PKVFLGGLPSNVT 394
               +DGR  +    +  R    P RG G    P  +  G PS  T
Sbjct: 78  PNPVIDGRKANCNIASFGRPRPSPPRGRGQTGSPSQYQSGGPSTYT 123


>At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing
           protein similar to RNA recognition motif-containing
           protein SEB-4 GI:8895698 from [Xenopus laevis]; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 287

 Score = 74.1 bits (174), Expect = 6e-14
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  + ++RYF ++GE+++ V++ +  +G+S+G+GFVTF +       + +
Sbjct: 18  KVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVAD 77

Query: 269 GPHQLDGRTIDPKPCN-PRTLQKPKRGGGY---PKVFLGGLPSNVT 394
               +DGR  +    +  R    P RG G    P  +  G PS  T
Sbjct: 78  PNPVIDGRKANCNIASFGRPRPSPPRGRGQTGSPSQYQSGGPSTYT 123


>At5g61030.1 68418.m07659 RNA-binding protein, putative similar to
           RNA-binding protein from [Solanum tuberosum]
           GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana
           sylvestris] GI:624925; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 309

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 36/90 (40%), Positives = 53/90 (58%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GG+++   +++L+  F++YGEV+D  V+ + E+GRSRGFGFVTF      +  +Q 
Sbjct: 41  KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100

Query: 269 -GPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
                L GR +     N RT      GGGY
Sbjct: 101 LDGRDLHGRVVKVNYANDRTSGGGFGGGGY 130



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 10/29 (34%), Positives = 20/29 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F +YG+V++  ++ D+   +S G GF++F
Sbjct: 60  FTKYGEVVDTRVILDRETGRSRGFGFVTF 88


>At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 105

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 31/50 (62%), Positives = 41/50 (82%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           + FVGGL+W T+ E+LQR FS++G+VID  ++ + ESGRSRGFGFVTF D
Sbjct: 7   RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F ++G V++  I+ D+   +S G GF++F+DE
Sbjct: 26  FSQFGDVIDSKIINDRESGRSRGFGFVTFKDE 57


>At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM); similar to
           GB:AAC33496
          Length = 347

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           + D    K+FVGGL+WET +E ++++F ++GE+++ VV+ +  SGRS+G+GFVTF +   
Sbjct: 7   LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTL 427
                 +    +DGR  +   CN  +L   +     P    GG  +N     +R +  T+
Sbjct: 67  ARSACVDATPVIDGRRAN---CNLASLGLQRSKPSTPNHGGGGRINN-----MRVMMSTM 118

Query: 428 WEGHG 442
             G G
Sbjct: 119 QTGFG 123


>At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM); similar to
           GB:AAC33496
          Length = 242

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           + D    K+FVGGL+WET +E ++++F ++GE+++ VV+ +  SGRS+G+GFVTF +   
Sbjct: 7   LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTL 427
                 +    +DGR  +   CN  +L   +     P    GG  +N     +R +  T+
Sbjct: 67  ARSACVDATPVIDGRRAN---CNLASLGLQRSKPSTPNHGGGGRINN-----MRVMMSTM 118

Query: 428 WEGHG 442
             G G
Sbjct: 119 QTGFG 123


>At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM); similar to
           GB:AAC33496
          Length = 249

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           + D    K+FVGGL+WET +E ++++F ++GE+++ VV+ +  SGRS+G+GFVTF +   
Sbjct: 7   LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTL 427
                 +    +DGR  +   CN  +L   +     P    GG  +N     +R +  T+
Sbjct: 67  ARSACVDATPVIDGRRAN---CNLASLGLQRSKPSTPNHGGGGRINN-----MRVMMSTM 118

Query: 428 WEGHG 442
             G G
Sbjct: 119 QTGFG 123


>At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains Pfam
           profile: PF00076 RNA recognition motif (aka RRM, RBD, or
           RNP domain)
          Length = 382

 Score = 72.9 bits (171), Expect = 1e-13
 Identities = 32/89 (35%), Positives = 50/89 (56%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D  +  +FV GL W+T+ ENL+  F  YGE+ +C V+ + ++GR++GFGFV F       
Sbjct: 159 DSSQRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGAR 218

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
             L+N   ++  RT+   P  P    KP+
Sbjct: 219 AALKNPEKRMYNRTVSCLPARPFNSGKPR 247


>At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative
           similar to RNA binding protein(RZ-1) GI:1435061 from
           [Nicotiana sylvestris]; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 292

 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 33/100 (33%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D + + ++FVGGLSW+ ++  L+  F RYG++ +C +M   ++GR RGFGF+TF D    
Sbjct: 7   DGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGA 66

Query: 251 NLVLQN-GPHQLDGRTIDPKPCNPRT----LQKPKRGGGY 355
           +  +++    +L  + I      P+     + + K+GGGY
Sbjct: 67  DDAIKHMHGRELGNKVISVNKAEPKVGGEDVDQLKKGGGY 106



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH*PPREAG 569
           F RYGK+ E  IM  +   +  G GF++F D      +D    H   RE G
Sbjct: 32  FDRYGKITECQIMVGRDTGRPRGFGFITFTDRRG---ADDAIKHMHGRELG 79


>At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative
           similar to RNA binding protein(RZ-1) GI:1435061 from
           [Nicotiana sylvestris]; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 292

 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 33/100 (33%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D + + ++FVGGLSW+ ++  L+  F RYG++ +C +M   ++GR RGFGF+TF D    
Sbjct: 7   DGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGA 66

Query: 251 NLVLQN-GPHQLDGRTIDPKPCNPRT----LQKPKRGGGY 355
           +  +++    +L  + I      P+     + + K+GGGY
Sbjct: 67  DDAIKHMHGRELGNKVISVNKAEPKVGGEDVDQLKKGGGY 106



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH*PPREAG 569
           F RYGK+ E  IM  +   +  G GF++F D      +D    H   RE G
Sbjct: 32  FDRYGKITECQIMVGRDTGRPRGFGFITFTDRRG---ADDAIKHMHGRELG 79


>At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to
           RNA binding protein GI:18181938 from (Arabidopsis
           thaliana); contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
           domain 15450911 gb AY054536.1
          Length = 360

 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 51/140 (36%), Positives = 76/140 (54%), Gaps = 25/140 (17%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D ++ KLFVGG++ ETS+E L++YFSRYG V++ VV K   +G+ RGFGFV FA+   V 
Sbjct: 2   DYDRYKLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVV 61

Query: 254 LVLQNGPHQLDGRTIDPKPC--------NPRTLQKPKR-----GGGY------------P 358
             L++  H + G+ +D +           P ++Q  +R      GG              
Sbjct: 62  KALRD-THFILGKPVDVRKAIRKHELYQQPFSMQFLERKVQQMNGGLREMSSNGVTSRTK 120

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           K+F+GGL SN TE + +  F
Sbjct: 121 KIFVGGLSSNTTEEEFKSYF 140



 Score = 72.1 bits (169), Expect = 2e-13
 Identities = 32/78 (41%), Positives = 48/78 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS  T++E  + YF R+G   D VVM +  + R RGFGFVT+     V +V+Q+
Sbjct: 121 KIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQS 180

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H+L  + ++ K   P+
Sbjct: 181 NFHELSDKRVEVKRAIPK 198



 Score = 34.7 bits (76), Expect = 0.046
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F R+G+  +VV+M+D    +  G GF++++ E S
Sbjct: 139 YFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDS 173



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F RYG V+E V+  ++   K  G GF+ F ++
Sbjct: 25  YFSRYGAVLEAVVAKEKVTGKPRGFGFVRFAND 57


>At5g04280.1 68418.m00421 glycine-rich RNA-binding protein
          Length = 310

 Score = 72.1 bits (169), Expect = 2e-13
 Identities = 29/53 (54%), Positives = 42/53 (79%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           E  ++FVGGLS E +  +L+R FSR+G+++DC +M   ++GRSRGFGF+TFAD
Sbjct: 5   EGSRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFAD 57



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 12/38 (31%), Positives = 23/38 (60%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QS 530
           F R+G +++  IM ++   +S G GF++F D  +  +S
Sbjct: 27  FSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDES 64


>At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)
           SP|Q03250 Glycine-rich RNA-binding protein 7
           {Arabidopsis thaliana}
          Length = 159

 Score = 71.3 bits (167), Expect = 4e-13
 Identities = 35/76 (46%), Positives = 50/76 (65%), Gaps = 2/76 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D + + FVGGL+W T    L+  F++YG+VID  ++ + E+GRSRGFGFVTF D   +  
Sbjct: 5   DVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKD 64

Query: 257 VLQ--NGPHQLDGRTI 298
            ++  NG   LDGR+I
Sbjct: 65  AIEGMNG-QDLDGRSI 79



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F +YG V++  I+ D+   +S G GF++F+DE
Sbjct: 28  FAQYGDVIDSKIINDRETGRSRGFGFVTFKDE 59


>At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)
           SP|Q03250 Glycine-rich RNA-binding protein 7
           {Arabidopsis thaliana}
          Length = 176

 Score = 71.3 bits (167), Expect = 4e-13
 Identities = 35/76 (46%), Positives = 50/76 (65%), Gaps = 2/76 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D + + FVGGL+W T    L+  F++YG+VID  ++ + E+GRSRGFGFVTF D   +  
Sbjct: 5   DVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKD 64

Query: 257 VLQ--NGPHQLDGRTI 298
            ++  NG   LDGR+I
Sbjct: 65  AIEGMNG-QDLDGRSI 79



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F +YG V++  I+ D+   +S G GF++F+DE
Sbjct: 28  FAQYGDVIDSKIINDRETGRSRGFGFVTFKDE 59


>At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 100

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 31/78 (39%), Positives = 47/78 (60%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D + K++V GL W T  E L  YF R+GE++   V+ +  + RS+GFGFVTF +     
Sbjct: 5   NDRETKIYVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESAT 64

Query: 254 LVLQNGPHQLDGRTIDPK 307
              +N  H +DGRT++ K
Sbjct: 65  RACENPNHTIDGRTVNCK 82



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F R+G+++   ++ D   ++S G GF++F +  S
Sbjct: 28  YFERFGEIVYAKVVCDGATQRSKGFGFVTFREVES 62


>At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar
           to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana
           sylvestris]; contains Pfam profile: PF00076 RNA
           recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 245

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M +D + + F+GGL+W TS   L+  F +YG +++  V+ +  SGRSRGFGF+TF +   
Sbjct: 1   MSEDPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKA 60

Query: 248 VN--LVLQNGPHQLDGRTIDPKPCNP 319
           ++  +   NG   LDGRTI      P
Sbjct: 61  MDEAIAAMNG-MDLDGRTITVDKAQP 85



 Score = 31.9 bits (69), Expect = 0.33
 Identities = 14/51 (27%), Positives = 27/51 (52%)
 Frame = +3

Query: 360 RCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           RC + G   T         F +YG ++E  ++ D+   +S G GF++F+++
Sbjct: 8   RCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEK 58


>At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein 2,
           mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8)
           [Arabidopsis thaliana]; contains Pfam profile: PF00076
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 136

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 39/94 (41%), Positives = 57/94 (60%), Gaps = 5/94 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA-DPSLVNLVLQ 265
           KLFVGGLSW T   +L++ F+ +GEV +  V+ + E+GRSRGFGFV+F+ + S  N + +
Sbjct: 36  KLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKE 95

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKR----GGGY 355
               +L+GR I       R+   P+     GGGY
Sbjct: 96  MDGKELNGRQIRVNLATERS-SAPRSSFGGGGGY 128


>At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein 2,
           mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8)
           [Arabidopsis thaliana]; contains Pfam profile: PF00076
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 136

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 39/94 (41%), Positives = 57/94 (60%), Gaps = 5/94 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA-DPSLVNLVLQ 265
           KLFVGGLSW T   +L++ F+ +GEV +  V+ + E+GRSRGFGFV+F+ + S  N + +
Sbjct: 36  KLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKE 95

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKR----GGGY 355
               +L+GR I       R+   P+     GGGY
Sbjct: 96  MDGKELNGRQIRVNLATERS-SAPRSSFGGGGGY 128


>At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein from {Daucus
           carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica
           napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251;
           contains InterPro entry IPR000504: RNA-binding region
           RNP-1 (RNA recognition motif) (RRM)
          Length = 185

 Score = 68.9 bits (161), Expect = 2e-12
 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 2/76 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D + + FVGGL+W T +++++R F+ +GEV D  ++ + E+GRS+GF FVTF D   +  
Sbjct: 41  DNEYRCFVGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRT 100

Query: 257 VL--QNGPHQLDGRTI 298
            +   NG  +LDGR I
Sbjct: 101 AIDRMNG-QELDGRNI 115


>At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar
           to RNA-binding protein GB:S46286 from [Nicotiana
           sylvestris]
          Length = 289

 Score = 68.5 bits (160), Expect = 3e-12
 Identities = 36/90 (40%), Positives = 49/90 (54%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+S+ T +  L+  FS+YGEV+D  ++ + E+GRSRGF FVTF      +  +Q 
Sbjct: 35  KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQL 94

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
               L GR I       R      RG G P
Sbjct: 95  DGQDLHGRRIRVNYATERGSGFGGRGFGGP 124


>At5g06210.1 68418.m00693 RNA-binding protein, putative contains
           similarity to RNA-binding protein from [Nicotiana
           tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925,
           [Solanum tuberosum] GI:15822705; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 146

 Score = 66.9 bits (156), Expect = 9e-12
 Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 2/92 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           KLF+GGLS+ T+++ L   FS+ G+V++  ++ +  S RS+GFGFVTF  AD +   L+ 
Sbjct: 35  KLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALME 94

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
            NG  QL+GRTI       +  Q    GGGYP
Sbjct: 95  FNG-QQLNGRTIFVDYAKAK--QSLGGGGGYP 123


>At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative
          Length = 358

 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 28/80 (35%), Positives = 51/80 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+   ++   ++YF+++G + D VVM +  + R RGFGF+++     V+ VLQ 
Sbjct: 34  KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQK 93

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ +
Sbjct: 94  TFHELNGKMVEVKLAVPKDM 113



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 14/45 (31%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF+S++ E +  +   +T H
Sbjct: 52  YFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFH 96



 Score = 27.1 bits (57), Expect = 9.3
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           K+F+GGL S+VTE + +  F
Sbjct: 34  KIFVGGLASSVTEAEFKKYF 53


>At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative
           similar to glycine-rich RNA-binding protein from
           {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum
           sativum]; contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 155

 Score = 65.7 bits (153), Expect = 2e-11
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS  T  E L+  F  +G+++D VV+ + ESG SRGFGFVT+    + N  +Q 
Sbjct: 37  KIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA 96

Query: 269 GPH-QLDGRTIDPKPCN 316
             + +LDGR I   P +
Sbjct: 97  MQNKELDGRIIGVHPAD 113



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 10/30 (33%), Positives = 21/30 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG +GK+++ V++ D+    S G GF++++
Sbjct: 56  FGSFGKIVDAVVVLDRESGLSRGFGFVTYD 85


>At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein RNP-T, putative /
           RNA-binding protein 1/2/3, putative / RNA-binding
           protein cp31, putative similar to SP|Q04836 31 kDa
           ribonucleoprotein, chloroplast precursor (RNA-binding
           protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis
           thaliana}; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 289

 Score = 64.5 bits (150), Expect = 5e-11
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   +++VG L W+     L+R FS +G+V+D  V+ + E+GRSRGFGFV  ++ + VN+
Sbjct: 204 DAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNV 263

Query: 257 VLQNGPHQ-LDGRTIDPKPCNPRT 325
            +     Q L+GR I       RT
Sbjct: 264 AIAALDGQNLEGRAIKVNVAEERT 287



 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 32/117 (27%), Positives = 57/117 (48%), Gaps = 4/117 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ KLFVG L ++   + L   F + G V    V+ N ++ +SRGFGFVT +        
Sbjct: 111 EEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKA 170

Query: 260 LQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP---KVFLGGLPSNVTETDLRXIF 418
           ++     +++GR +      PR  +  ++   Y    ++++G LP +V    L  +F
Sbjct: 171 VEKFNSFEVNGRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLF 227



 Score = 27.1 bits (57), Expect = 9.3
 Identities = 10/32 (31%), Positives = 19/32 (59%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  +GKV++  ++ D+   +S G GF+   +E
Sbjct: 227 FSEHGKVVDARVVSDRETGRSRGFGFVQMSNE 258


>At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing
           protein low similarity to RRM-containing protein SEB-4
           [Xenopus laevis] GI:8895698; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 261

 Score = 64.1 bits (149), Expect = 7e-11
 Identities = 26/79 (32%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +N    D +  K+FVGGL+W+T +E +  +F +YG++++ V++ +  + RS+G+GFVTF 
Sbjct: 7   VNGCFGDTKLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFK 66

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D        ++    ++GR
Sbjct: 67  DAKAATRACEDSTPIINGR 85



 Score = 35.1 bits (77), Expect = 0.035
 Identities = 13/31 (41%), Positives = 23/31 (74%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG ++E VI+ D+  ++S G GF++F+D
Sbjct: 37  FIKYGDILEAVIISDKLTRRSKGYGFVTFKD 67


>At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing
           protein low similarity to RRM-containing protein SEB-4
           [Xenopus laevis] GI:8895698; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 169

 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 28/73 (38%), Positives = 44/73 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++VGGL W T +E L  +F R+GE+I   V+ + E+ RS+G+GFVTF D        ++
Sbjct: 14  KIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKD 73

Query: 269 GPHQLDGRTIDPK 307
               ++GR  + K
Sbjct: 74  PNPTIEGRITNCK 86



 Score = 34.3 bits (75), Expect = 0.061
 Identities = 13/35 (37%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF R+G+++ V ++ D+   +S G GF++F+D  S
Sbjct: 32  FFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAES 66


>At2g37510.1 68415.m04600 RNA-binding protein, putative similar to
           SP|P10979 Glycine-rich RNA-binding, abscisic
           acid-inducible protein {Zea mays}; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 142

 Score = 61.3 bits (142), Expect = 5e-10
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           +LFV GLS  T+ E LQ  F+ +G+++D  V+ + +SGRS+GFGFVT+A          +
Sbjct: 35  RLFVSGLSRLTTNEKLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAE 94

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKP 337
                LDG  I   P  PR  ++P
Sbjct: 95  MNAKFLDGWVIFVDPARPREPRRP 118


>At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains Pfam
           profile: PF00076 RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 404

 Score = 60.9 bits (141), Expect = 6e-10
 Identities = 29/81 (35%), Positives = 51/81 (62%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           +R+  D D  ++ KLF+ GL+ +T+ E L+  FS YG++ + +V+ +  +G+S+G+GFVT
Sbjct: 64  VRLTADSDISQR-KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVT 122

Query: 230 FADPSLVNLVLQNGPHQLDGR 292
           F       L L+    ++DGR
Sbjct: 123 FMHVDGALLALKEPSKKIDGR 143



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 16/73 (21%), Positives = 35/73 (47%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++V  + ++   + L  +F  YG+V +  +  +  +G+SRGF    +         L +
Sbjct: 168 KIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALAD 227

Query: 269 GPHQLDGRTIDPK 307
               +DG+ ++ K
Sbjct: 228 PVKVIDGKHLNCK 240



 Score = 29.5 bits (63), Expect = 1.7
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  YG + E +++ D+   KS G GF++F
Sbjct: 95  FSSYGDLEEAIVILDKVTGKSKGYGFVTF 123


>At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains Pfam
           profile: PF00076 RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 404

 Score = 60.9 bits (141), Expect = 6e-10
 Identities = 29/81 (35%), Positives = 51/81 (62%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           +R+  D D  ++ KLF+ GL+ +T+ E L+  FS YG++ + +V+ +  +G+S+G+GFVT
Sbjct: 64  VRLTADSDISQR-KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVT 122

Query: 230 FADPSLVNLVLQNGPHQLDGR 292
           F       L L+    ++DGR
Sbjct: 123 FMHVDGALLALKEPSKKIDGR 143



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 16/73 (21%), Positives = 35/73 (47%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++V  + ++   + L  +F  YG+V +  +  +  +G+SRGF    +         L +
Sbjct: 168 KIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALAD 227

Query: 269 GPHQLDGRTIDPK 307
               +DG+ ++ K
Sbjct: 228 PVKVIDGKHLNCK 240



 Score = 29.5 bits (63), Expect = 1.7
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  YG + E +++ D+   KS G GF++F
Sbjct: 95  FSSYGDLEEAIVILDKVTGKSKGYGFVTF 123


>At3g08000.1 68416.m00977 RNA-binding protein, putative similar to
           RNA-binding protein from [Nicotiana tabacum]
           GI:15822703, [Nicotiana sylvestris] GI:624925; contains
           Pfam profile: PF00076 RNA recognition motif. (a.k.a.
           RRM, RBD, or RNP domain)
          Length = 143

 Score = 60.9 bits (141), Expect = 6e-10
 Identities = 26/50 (52%), Positives = 36/50 (72%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           KLF+GGLSW   +++L+  FS +GEV +  +  +  SGRSRGFGFV FA+
Sbjct: 42  KLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAE 91



 Score = 33.5 bits (73), Expect = 0.11
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  +G+V EV I YD+   +S G GF+ F +E
Sbjct: 61  FSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEE 92


>At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein RNP-T, putative /
           RNA-binding protein 1/2/3, putative / RNA-binding
           protein cp31, putative similar to SP|Q04836 31 kDa
           ribonucleoprotein, chloroplast precursor (RNA-binding
           protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33)
           (RNA-binding protein cp31) {Arabidopsis thaliana};
           contains InterPro entry IPR000504: RNA-binding region
           RNP-1 (RNA recognition motif) (RRM)
          Length = 329

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 32/87 (36%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG L W+     L++ FS +G+V++  V+ + E+GRSRGFGFVT +D   +N  +  
Sbjct: 245 RVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304

Query: 269 GPHQ-LDGRTIDPKPCNPRTLQKPKRG 346
              Q L+GR I       R    P+RG
Sbjct: 305 LDGQNLEGRAIRVNVAEER---PPRRG 328



 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 4/120 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +  E+ KLFVG L+++ + + L   F + G V    V+ N E+ +SRGFGFVT +     
Sbjct: 145 EPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEA 204

Query: 251 NLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP---KVFLGGLPSNVTETDLRXIF 418
              ++    + L+GR +      PR  +  +    Y    +V++G LP +V    L  +F
Sbjct: 205 ETAVEKFNRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLF 264



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F  +GKV+E  ++YD+   +S G GF++  D
Sbjct: 264 FSEHGKVVEARVVYDRETGRSRGFGFVTMSD 294


>At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM); contains Pfam profile PF00096:
           Zinc finger, C2H2 type
          Length = 613

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 30/92 (32%), Positives = 50/92 (54%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D  +  +FV G  W+T+QENL+  F  YGE+ +C V+ + ++GR +G+GFV F       
Sbjct: 404 DIAQRNIFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAR 463

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
             L+    ++  R +    CN  + +KP + G
Sbjct: 464 EALKRPEKRMYNRIV---VCNLAS-EKPGKAG 491


>At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein 2,
           mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8)
           [Arabidopsis thaliana] ; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 87

 Score = 57.2 bits (132), Expect = 8e-09
 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 1/74 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG LS  T+ + L+  FS YG V+D +VM++  + RSRGFGFVT++  S     +  
Sbjct: 4   RVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSG 63

Query: 269 -GPHQLDGRTIDPK 307
               +L+GR +  K
Sbjct: 64  MDGKELNGRRVSVK 77



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  YG V++ ++M D+   +S G GF+++
Sbjct: 23  FSGYGNVVDAIVMRDRYTDRSRGFGFVTY 51


>At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly
           identical to UBP1 interacting protein 1a [Arabidopsis
           thaliana] GI:19574236; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM); based on cDNA of partial mRNA for UBP1
           interacting protein 1a (uba1a) GI:19574235
          Length = 347

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           K+FV GL WET++E L   F  YGE+ +C V+ +  +G+++GFGFV F
Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = +3

Query: 387 TLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           T  + + G F G YG++ E  ++ D+   K+ G GF+ F+
Sbjct: 115 TTRETLVGVFEG-YGEIEECTVVIDKATGKAKGFGFVMFK 153


>At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly
           identical to UBP1 interacting protein 1a [Arabidopsis
           thaliana] GI:19574236; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM); based on cDNA of partial mRNA for UBP1
           interacting protein 1a (uba1a) GI:19574235
          Length = 343

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           K+FV GL WET++E L   F  YGE+ +C V+ +  +G+++GFGFV F
Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = +3

Query: 387 TLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           T  + + G F G YG++ E  ++ D+   K+ G GF+ F+
Sbjct: 115 TTRETLVGVFEG-YGEIEECTVVIDKATGKAKGFGFVMFK 153


>At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp29, putative similar to
           29 kDa ribonucleoprotein chloroplast precursor
           {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM) contains an AG-donor site at
           intron.
          Length = 258

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG LSW  + E+L   F   G+V+   V+ + ++GRSRG+GFV ++  + +   L++
Sbjct: 178 KLFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALES 237

Query: 269 -GPHQLDGRTI 298
               +L+GR I
Sbjct: 238 LDGFELEGRAI 248



 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 3/114 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL+ G L +      L +    +       V+ N ++G+SRGF FVT ++    N+++ N
Sbjct: 86  KLYFGNLPYNVDSATLAQIIQDFANPELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDN 145

Query: 269 --GPHQLDGRTIDPKPCN-PRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
             G   L GR +     + P+  ++P       K+F+G L   VT   L   FR
Sbjct: 146 LDGTEYL-GRALKVNFADKPKPNKEPLYPETEHKLFVGNLSWTVTSESLAGAFR 198


>At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a)
           identical to UBP1 interacting protein 2a [Arabidopsis
           thaliana] GI:19682816; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D    K+FV GL W+T  E L   F +YGE+ DC  + +  SG+S+G+GF+ +   S  
Sbjct: 135 EDPVHRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGA 194

Query: 251 NLVLQNGPHQLDGR 292
              L+    ++  R
Sbjct: 195 RNALKQPQKKIGSR 208



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++V  +  E   + L  +FS++GE+ +  +  +  +GR +GF    +         L+ 
Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEE 305

Query: 269 GPHQ 280
            PH+
Sbjct: 306 -PHK 308


>At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a)
           identical to UBP1 interacting protein 2a [Arabidopsis
           thaliana] GI:19682816; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D    K+FV GL W+T  E L   F +YGE+ DC  + +  SG+S+G+GF+ +   S  
Sbjct: 135 EDPVHRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGA 194

Query: 251 NLVLQNGPHQLDGR 292
              L+    ++  R
Sbjct: 195 RNALKQPQKKIGSR 208



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++V  +  E   + L  +FS++GE+ +  +  +  +GR +GF    +         L+ 
Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEE 305

Query: 269 GPHQ 280
            PH+
Sbjct: 306 -PHK 308


>At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a)
           identical to UBP1 interacting protein 2a [Arabidopsis
           thaliana] GI:19682816; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D    K+FV GL W+T  E L   F +YGE+ DC  + +  SG+S+G+GF+ +   S  
Sbjct: 135 EDPVHRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGA 194

Query: 251 NLVLQNGPHQLDGR 292
              L+    ++  R
Sbjct: 195 RNALKQPQKKIGSR 208



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++V  +  E   + L  +FS++GE+ +  +  +  +GR +GF    +         L+ 
Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEE 305

Query: 269 GPHQ 280
            PH+
Sbjct: 306 -PHK 308


>At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /
           RNA-binding protein cp 29 nearly identical to SP|Q43349
           29 kDa ribonucleoprotein, chloroplast precursor
           (RNA-binding protein cp29) {Arabidopsis thaliana}
          Length = 334

 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG LSW      L+  F+  G+V++  V+ + +SGRS+GFGFVT +    V   +  
Sbjct: 250 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 309

Query: 266 -NGPHQLDGRTI 298
            NG   LDGR I
Sbjct: 310 LNGA-DLDGRQI 320



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 7/106 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG LS+      L + F   G V    V+ +  +GRSRGFGFVT +  + V    Q 
Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQ 159

Query: 266 -NGPHQLDGRTI-----DPKPCNPRTLQKPKRGGGYPKVFLGGLPS 385
            NG ++ +GR +      P P    +  +  R GGY     GG  S
Sbjct: 160 FNG-YEFEGRPLRVNAGPPPPKREESFSRGPRSGGYGSERGGGYGS 204



 Score = 29.1 bits (62), Expect = 2.3
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           F   GKV+E  ++YD+   +S G GF++
Sbjct: 269 FNEQGKVVEARVIYDRDSGRSKGFGFVT 296


>At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /
           RNA-binding protein cp 29 nearly identical to SP|Q43349
           29 kDa ribonucleoprotein, chloroplast precursor
           (RNA-binding protein cp29) {Arabidopsis thaliana}
          Length = 342

 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG LSW      L+  F+  G+V++  V+ + +SGRS+GFGFVT +    V   +  
Sbjct: 258 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 317

Query: 266 -NGPHQLDGRTI 298
            NG   LDGR I
Sbjct: 318 LNGA-DLDGRQI 328



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 7/106 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG LS+      L + F   G V    V+ +  +GRSRGFGFVT +  + V    Q 
Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQ 159

Query: 266 -NGPHQLDGRTI-----DPKPCNPRTLQKPKRGGGYPKVFLGGLPS 385
            NG ++ +GR +      P P    +  +  R GGY     GG  S
Sbjct: 160 FNG-YEFEGRPLRVNAGPPPPKREESFSRGPRSGGYGSERGGGYGS 204



 Score = 29.1 bits (62), Expect = 2.3
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           F   GKV+E  ++YD+   +S G GF++
Sbjct: 277 FNEQGKVVEARVIYDRDSGRSKGFGFVT 304


>At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp29, putative similar to
           SP|Q43349 29 kDa ribonucleoprotein, chloroplast
           precursor (RNA-binding protein cp29) {Arabidopsis
           thaliana}
          Length = 289

 Score = 55.2 bits (127), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNLVLQ 265
           +++VG LSW      L+  FS  G+V++  V+ + +SGRS+GFGFVT+ +   + N +  
Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKS 264

Query: 266 NGPHQLDGRTI 298
                LDGR I
Sbjct: 265 LDGADLDGRQI 275



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 35/93 (37%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG L +      L + F   G V    V+ +  +GRSRGFGFVT +  S V    Q 
Sbjct: 92  KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQ 151

Query: 266 -NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
            NG ++LDGR +      P     PKR  G+ +
Sbjct: 152 FNG-YELDGRPLRVNAGPP----PPKREDGFSR 179



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           F   GKV+E  ++YD+   +S G GF++++
Sbjct: 224 FSEQGKVVEARVIYDRDSGRSKGFGFVTYD 253


>At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 451

 Score = 54.0 bits (124), Expect = 7e-08
 Identities = 22/52 (42%), Positives = 34/52 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           K+FV GL W+T  ++L   F +YGE+ DC  + +  SG+S+G+GF+ F   S
Sbjct: 129 KIFVHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRS 180



 Score = 34.3 bits (75), Expect = 0.061
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++V  +S +   + L  +FSR+GE+ +  +  +  +GR +GF    +         L+ 
Sbjct: 228 KIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEE 287

Query: 269 GPHQ 280
            PH+
Sbjct: 288 -PHK 290


>At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing
           protein low similarity to RNA-binding protein RGP-3
           [Nicotiana sylvestris] GI:1009363; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 156

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 2/79 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           LFV GLS  T+ E L+  F+++GEV D  V+ +  SG S+GFGFV +A  + S   +   
Sbjct: 58  LFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIAGM 117

Query: 266 NGPHQLDGRTIDPKPCNPR 322
           +G   LDG  I  +   PR
Sbjct: 118 DGKF-LDGWVIFAEYARPR 135


>At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)
           identical to GB:Q05196 from [Arabidopsis thaliana]
          Length = 668

 Score = 52.4 bits (120), Expect = 2e-07
 Identities = 28/73 (38%), Positives = 42/73 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L++  L    + E L+  FS YG V  C VM NS+ G SRGFGFV +++P    L ++  
Sbjct: 330 LYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQ-GLSRGFGFVAYSNPEEALLAMK-- 386

Query: 272 PHQLDGRTIDPKP 310
             +++G+ I  KP
Sbjct: 387 --EMNGKMIGRKP 397



 Score = 47.2 bits (107), Expect = 8e-06
 Identities = 21/58 (36%), Positives = 35/58 (60%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++V  L  E + + L++ F +YG++   VVMK+ +SG SR FGFV F  P    + ++
Sbjct: 227 VYVKNLPKEITDDELKKTFGKYGDISSAVVMKD-QSGNSRSFGFVNFVSPEAAAVAVE 283



 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 4/116 (3%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           KG +F+  L      + L   FS +G ++ C V  +   GRS+G+GFV F         +
Sbjct: 131 KGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVV-GRSKGYGFVQFEKEETAQAAI 189

Query: 263 Q--NGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDLRXIF 418
              NG    D +         +   + + G    +  V++  LP  +T+ +L+  F
Sbjct: 190 DKLNGMLLNDKQVFVGHFVRRQDRARSESGAVPSFTNVYVKNLPKEITDDELKKTF 245



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)
 Frame = +3

Query: 384 RTLPKPISGX----FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           + LPK I+       FG+YG +   V+M DQ    S   GF++F
Sbjct: 230 KNLPKEITDDELKKTFGKYGDISSAVVMKDQ-SGNSRSFGFVNF 272


>At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial
           (RPS19)
          Length = 212

 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-- 262
           KL++GGLS  T + +L+  FS +  V +  VM N  +GRSRG+GFV F      N  +  
Sbjct: 32  KLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91

Query: 263 QNGPHQLDGRTI 298
            NG  +L+G  I
Sbjct: 92  MNG-QELNGFNI 102


>At5g51300.2 68418.m06360 splicing factor-related contains
           similarity to SF1 protein [Drosophila melanogaster]
           GI:6687400
          Length = 804

 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  + DE   L++G L      + L   FS +GE++   V+K+  +G S+G+GFV +AD 
Sbjct: 473 PSKEYDETN-LYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADV 531

Query: 242 SLVNLVLQ--NGPHQLDGRTI 298
            + N  +Q  NG ++ +GRT+
Sbjct: 532 QMANTAVQAMNG-YRFEGRTL 551


>At5g51300.1 68418.m06359 splicing factor-related contains
           similarity to SF1 protein [Drosophila melanogaster]
           GI:6687400
          Length = 804

 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  + DE   L++G L      + L   FS +GE++   V+K+  +G S+G+GFV +AD 
Sbjct: 473 PSKEYDETN-LYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADV 531

Query: 242 SLVNLVLQ--NGPHQLDGRTI 298
            + N  +Q  NG ++ +GRT+
Sbjct: 532 QMANTAVQAMNG-YRFEGRTL 551


>At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing
           protein similar to nucleolin protein; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 495

 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 31/117 (26%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F+GGL  +  +E+L+      GE+ +  +MK+ +SG S+G+ FV F    +    ++ 
Sbjct: 117 EVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEE 176

Query: 269 -GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
               +  G+TI    C   +L + K      ++F+G +P N TE + R +   +  G
Sbjct: 177 LHSKEFKGKTI---RC---SLSETKN-----RLFIGNIPKNWTEDEFRKVIEDVGPG 222


>At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp33, putative similar to
           33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana
           sylvestris]
          Length = 293

 Score = 50.8 bits (116), Expect = 7e-07
 Identities = 22/74 (29%), Positives = 42/74 (56%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           + + K++VG L W T  + L+ +FS++G ++   V+ + ++GR+R F F++F      + 
Sbjct: 209 ESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDA 268

Query: 257 VLQNGPHQLDGRTI 298
            L     Q +GR I
Sbjct: 269 ALSFNGTQYEGRRI 282



 Score = 33.5 bits (73), Expect = 0.11
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 4/79 (5%)
 Frame = +2

Query: 146 FSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN-GPHQLDGRTIDPK---PC 313
           F  +G VI   V +N ++G SRG G+VT    +   + + +    ++ GR +  +     
Sbjct: 128 FQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDM 187

Query: 314 NPRTLQKPKRGGGYPKVFL 370
           NP T + P+     PK  L
Sbjct: 188 NPGTRRNPEVLNSTPKKIL 206


>At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 352

 Score = 50.4 bits (115), Expect = 9e-07
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VGG+ ++ ++ +L   FS+YGE++D  ++++  +G+S+GF F+ + D     L + N 
Sbjct: 38  VYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILAVDNL 97

Query: 272 PHQLD-GRTIDPKPC 313
              L  GRTI    C
Sbjct: 98  NGALVLGRTIKVDHC 112



 Score = 34.3 bits (75), Expect = 0.061
 Identities = 13/34 (38%), Positives = 24/34 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG++++V ++ D+   KS G  FL++ED+ S
Sbjct: 56  FSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89


>At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein GI:1899187 from
           [Nicotiana tabacum]
          Length = 432

 Score = 50.4 bits (115), Expect = 9e-07
 Identities = 40/131 (30%), Positives = 62/131 (47%), Gaps = 17/131 (12%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPS-LVNLVLQ 265
           +FVG LS + S   L   FS +Y  V    V+ ++ +GRS+G+GFV F D +     + +
Sbjct: 199 IFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTE 258

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGY--------PK-------VFLGGLPSNVTET 400
               +   R +   P  PR     ++ GGY        P+       +F+GGL S+VT+ 
Sbjct: 259 MNGVKCSSRAMRIGPATPRKTNGYQQQGGYMPNGTLTRPEGDIMNTTIFVGGLDSSVTDE 318

Query: 401 DLRXIFRTLWE 433
           DL+  F    E
Sbjct: 319 DLKQPFNEFGE 329



 Score = 30.3 bits (65), Expect = 1.00
 Identities = 15/49 (30%), Positives = 27/49 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVGGL    + E+L++ F+ +GE++   +         +G GFV F +
Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPV------GKGCGFVQFVN 348


>At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp33, putative similar to
           chloroplast RNA-binding protein (cp33) GB:BAA06523
           (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539
           (1995)); contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 329

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+G+L+VG L +  +   L + F   G V+D  ++ +  + RSRGFGFVT          
Sbjct: 114 EEGRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEA 173

Query: 260 LQN-GPHQLDGRTI 298
           +Q     Q+ GRT+
Sbjct: 174 MQMFNSSQIGGRTV 187



 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN- 253
           D   K++ G L W  + + L+  F     V+   V+    +GRSRGFGF++F     V  
Sbjct: 216 DSPHKVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQS 275

Query: 254 -LVLQNGPHQLDGRTI 298
            L   NG  +++GR +
Sbjct: 276 ALATMNGV-EVEGRAL 290



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           FG  G V++V I+YD+   +S G GF++
Sbjct: 136 FGEAGTVVDVQIVYDKVTDRSRGFGFVT 163


>At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile:
           PF00076 RNA recognition motif
          Length = 636

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 30/117 (25%), Positives = 58/117 (49%), Gaps = 6/117 (5%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           LF G LS++ ++ +++ +F   GEV+D V + + + G  +G+G + FA P      L+  
Sbjct: 386 LFAGNLSYQIARSDIENFFKEAGEVVD-VRLSSFDDGSFKGYGHIEFASPEEAQKALEMN 444

Query: 272 PHQLDGRTIDPKPCN----PRTLQKPKRGGGYPK--VFLGGLPSNVTETDLRXIFRT 424
              L GR +     N    PR     ++G G     +++ G  S++ E +++   R+
Sbjct: 445 GKLLLGRDVRLDLANERGTPRNSNPGRKGEGSQSRTIYVRGFSSSLGEDEIKKELRS 501



 Score = 33.9 bits (74), Expect = 0.081
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           F   L  +  ++ L+ +FS+ GEV    V  + E+G SRGF ++     S  +  LQ   
Sbjct: 486 FSSSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDLT--SGFDEALQLSG 543

Query: 275 HQLDGRTIDPKPCNPR 322
            ++ G  I  +   PR
Sbjct: 544 SEIGGGNIHVEESRPR 559


>At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp33, putative similar to
           SP|P19684 33 kDa ribonucleoprotein, chloroplast
           precursor {Nicotiana sylvestris}; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 308

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 35/122 (28%), Positives = 52/122 (42%), Gaps = 10/122 (8%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K KLFV  L W  S  ++   F + G V +  +++  + G++RGF FVT A        +
Sbjct: 94  KRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKD-GKNRGFAFVTMASGEEAQAAI 152

Query: 263 QN-GPHQLDGRTID---------PKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                 Q+ GR I          P P +P  L  P  G    K+++  L      T LR 
Sbjct: 153 DKFDTFQVSGRIISVSFARRFKKPTPKSPNDLPSPAPGDTRHKLYVSNLAWKARSTHLRE 212

Query: 413 IF 418
           +F
Sbjct: 213 LF 214



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 3/80 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSR--YGEVIDCVVMKNSESGRSRGFGFVTFAD-PSL 247
           D + KL+V  L+W+    +L+  F+   +  V   VV  + E GRS G+GFV+FA     
Sbjct: 191 DTRHKLYVSNLAWKARSTHLRELFTAADFNPVSARVVFADPE-GRSSGYGFVSFATREEA 249

Query: 248 VNLVLQNGPHQLDGRTIDPK 307
            N + +    ++ GR I  K
Sbjct: 250 ENAITKLNGKEIMGRPITLK 269


>At2g21690.1 68415.m02580 RNA-binding protein, putative similar to
           Glycine-rich RNA-binding protein from {Sinapis alba}
           SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis
           thaliana} SP|Q03251; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 117

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           FV GL  +T +++L   FS++G VID  ++ + ++G+SR FGFVTF +
Sbjct: 10  FVRGLDQDTDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEE 57



 Score = 34.7 bits (76), Expect = 0.046
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +3

Query: 363 CSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           C + G  +   +      F ++G V++  I+YD+   KS   GF++FE+E S
Sbjct: 9   CFVRGLDQDTDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKS 60


>At3g46020.1 68416.m04979 RNA-binding protein, putative similar to
           Cold-inducible RNA-binding protein (Glycine-rich
           RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011,
           {Rattus norvegicus} SP|Q61413,{Xenopus laevis};
           SP|O93235; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 102

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 24/71 (33%), Positives = 45/71 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +LFV  LS  T+ ++L++ FS +G++ +  ++++SE+ R +GFGF+TF         L++
Sbjct: 8   QLFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALKS 67

Query: 269 GPHQLDGRTID 301
               LDG+ +D
Sbjct: 68  ----LDGKIVD 74


>At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing
           protein
          Length = 561

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 35/138 (25%), Positives = 66/138 (47%), Gaps = 14/138 (10%)
 Frame = +2

Query: 53  RMNPDMDDD-EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           ++ P+ D + ++  +F   ++   ++ ++  +FSR G+V D  ++ +  S RSRG G+V 
Sbjct: 170 KVEPEADPERDQRTVFAYQIALRATERDVYEFFSRAGKVRDVRIIMDRISRRSRGIGYVE 229

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPKPCNPR------TLQKPKRG-------GGYPKVFL 370
           F D   V + +      L G+ +  KP          T      G       GG  ++++
Sbjct: 230 FYDTMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSTTAAAGAGGMLGPYSGGARRLYV 289

Query: 371 GGLPSNVTETDLRXIFRT 424
           G L  N++E DLR +F +
Sbjct: 290 GNLHINMSEDDLRKVFES 307



 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 1/87 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           +L+VG L    S+++L++ F  +G V + V +   E+G  +GFGFV FA      N +  
Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSV-ELVQVPRDETGLCKGFGFVQFARLEDARNALNL 344

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRG 346
           NG  ++ GR I       +T + P+ G
Sbjct: 345 NGQLEIAGRAIKVSAVTDQT-EVPEAG 370



 Score = 34.7 bits (76), Expect = 0.046
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF R GKV +V I+ D+  ++S G G++ F D  S
Sbjct: 201 FFSRAGKVRDVRIIMDRISRRSRGIGYVEFYDTMS 235


>At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a)
           almost identical to SC35-like splicing factor SCL30a
           GI:9843661 from [Arabidopsis thaliana]; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 262

 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 27/79 (34%), Positives = 39/79 (49%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R     D D    L V  L  +  QE+L+R F ++G V D  + ++  +G  RGFGF+ F
Sbjct: 26  RFGGSRDSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQF 85

Query: 233 ADPSLVNLVLQNGPHQLDG 289
            DP+          HQ+DG
Sbjct: 86  MDPA----DAAEAKHQMDG 100


>At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein GI:1899187 from
           [Nicotiana tabacum]
          Length = 434

 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 38/131 (29%), Positives = 60/131 (45%), Gaps = 17/131 (12%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPS-LVNLVLQ 265
           +FVG L+ + S   L   FS +Y  V    V+ ++ +GRS+G+GFV F D +     + +
Sbjct: 201 IFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTE 260

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGY---------------PKVFLGGLPSNVTET 400
               +   R +   P  PR     ++ GGY                 +F+GGL S+VT+ 
Sbjct: 261 MNGVKCSSRAMRIGPATPRKTNGYQQQGGYMPSGAFTRSEGDTINTTIFVGGLDSSVTDE 320

Query: 401 DLRXIFRTLWE 433
           DL+  F    E
Sbjct: 321 DLKQPFSEFGE 331



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 161 EVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           E++   V++N  +G S G+GFV F    + + VLQ
Sbjct: 130 EIVSLKVIRNKHNGSSEGYGFVEFESHDVADKVLQ 164



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVGGL    + E+L++ FS +GE++   +         +G GFV F +
Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPV------GKGCGFVQFVN 350


>At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing
           protein low similarity to nucleolar phosphoprotein
           (Nopp52), Tetrahymena thermophila, EMBL:TT51555;
           contains InterPro entry IPR000504: RNA-binding region
           RNP-1 (RNA recognition motif) (RRM)
          Length = 597

 Score = 47.6 bits (108), Expect = 6e-06
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 11/131 (8%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + D     KL+VGG+ ++++++ ++ YF   G +I        E G   G  F+TF  
Sbjct: 152 NKEEDGVVPNKLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKMRPEDGAFSGIAFITFDT 211

Query: 239 PSLVNLVLQNGPHQLDGR--TID-----PKPCNPRTLQK----PKRGGGYPKVFLGGLPS 385
                  L      +  R  TI        P  PR        P+   GY +V++G L  
Sbjct: 212 EDGAKRALAFDRAAMGDRYLTIQQYVKTTTPSIPRRKTSSGFAPEMVDGYNRVYIGNLAW 271

Query: 386 NVTETDLRXIF 418
           + TE D+R +F
Sbjct: 272 DTTERDIRKLF 282



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 24/80 (30%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVM-KNSESGRSRGFGFVTFAD 238
           P+M D    ++++G L+W+T++ ++++ FS    VI+ V + KN E+G  +G+  V F D
Sbjct: 255 PEMVDGYN-RVYIGNLAWDTTERDIRKLFSDC--VINSVRLGKNKETGEFKGYAHVDFKD 311

Query: 239 PSLVNLVLQNGPHQLDGRTI 298
              V + L+     + GR +
Sbjct: 312 SVSVAIALKLDQQVICGRPV 331


>At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa,
           putative 
          Length = 333

 Score = 47.6 bits (108), Expect = 6e-06
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           LFVG LS  T+++ L+   S+YG + +  ++++  +G SRG+GFV +     +    ++ 
Sbjct: 66  LFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDA 125

Query: 272 PHQL-DGRTI 298
            H L DGR I
Sbjct: 126 HHSLIDGREI 135


>At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35
           contains similarity to splicing factor; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 303

 Score = 47.2 bits (107), Expect = 8e-06
 Identities = 30/104 (28%), Positives = 54/104 (51%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           PD+ D     L V  +++ T+ ++L   F++YG+V+D  + ++  +G SRGF FV +   
Sbjct: 10  PDISDTYS--LLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYK 67

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLG 373
              +  ++    +LDGR +D +     T+Q  K G    K+  G
Sbjct: 68  DEAHKAVE----RLDGRVVDGREI---TVQFAKYGPNAEKISKG 104


>At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35
           contains similarity to splicing factor; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 303

 Score = 47.2 bits (107), Expect = 8e-06
 Identities = 30/104 (28%), Positives = 54/104 (51%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           PD+ D     L V  +++ T+ ++L   F++YG+V+D  + ++  +G SRGF FV +   
Sbjct: 10  PDISDTYS--LLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYK 67

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLG 373
              +  ++    +LDGR +D +     T+Q  K G    K+  G
Sbjct: 68  DEAHKAVE----RLDGRVVDGREI---TVQFAKYGPNAEKISKG 104


>At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative
           contains similarity to polyadenylate-binding protein 5
          Length = 387

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 16/125 (12%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSR-YGEVIDCVVMKNSESGRSRGFGFVTFADPS--LVNLVL 262
           +FVG L+ E +   L   F   YG V    V+ +  +GRS+G+GFV FAD +  +  +  
Sbjct: 156 IFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTE 215

Query: 263 QNGPH----------QLDGRTIDPKPCNPRTLQKPKRGGGYPK---VFLGGLPSNVTETD 403
            NG +            +   +  +P   +  Q    G   P    +F+GGL +NVT+ +
Sbjct: 216 MNGQYCSTRPMRIGPAANKNALPMQPAMYQNTQGANAGDNDPNNTTIFVGGLDANVTDDE 275

Query: 404 LRXIF 418
           L+ IF
Sbjct: 276 LKSIF 280



 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 4/137 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP    D K  L++G L     +  +   F++ GE     V++N  +G+S G+GF+ F  
Sbjct: 52  NPGSASDVKS-LWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVS 110

Query: 239 PSLVNLVLQ--NG-PHQLDGRTIDPKPCNPRTLQKP-KRGGGYPKVFLGGLPSNVTETDL 406
            S+   VLQ  NG P     +T           +K  +  G    +F+G L   VT+  L
Sbjct: 111 HSVAERVLQTYNGAPMPSTEQTFRLNWAQAGAGEKRFQTEGPDHTIFVGDLAPEVTDYML 170

Query: 407 RXIFRTLWEGHGGGHYV 457
              F+ ++    G   V
Sbjct: 171 SDTFKNVYGSVKGAKVV 187



 Score = 31.9 bits (69), Expect = 0.33
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 5/104 (4%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N   +D     +FVGGL    + + L+  F ++GE++   +            GFV +A+
Sbjct: 251 NAGDNDPNNTTIFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRC------GFVQYAN 304

Query: 239 PSLVN--LVLQNGPHQLDGRTID---PKPCNPRTLQKPKRGGGY 355
            +     L + NG  QL G++I     +  N ++ Q    GGGY
Sbjct: 305 KASAEHALSVLNGT-QLGGQSIRLSWGRSPNKQSDQAQWNGGGY 347



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +3

Query: 402 ISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +S  F   YG V    ++ D+   +S G GF+ F DE
Sbjct: 170 LSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADE 206


>At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)
           non-consensus TA donor splice site at exon 2,
           polyadenylate-binding protein - Triticum aestivum
           (common wheat),PIR:T06979
          Length = 443

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 2/69 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVLQ 265
           ++V  L+  T+ ++L+  F  YG++   VVMK+ E G+S+GFGFV F  AD +   +   
Sbjct: 31  VYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGE-GKSKGFGFVNFENADDAARAVESL 89

Query: 266 NGPHQLDGR 292
           NG H+ D +
Sbjct: 90  NG-HKFDDK 97



 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 28/80 (35%), Positives = 39/80 (48%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D  +   L+V  L    S E L+  FS +G V    VM++  +G S+G GFV FA P   
Sbjct: 127 DKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDP-NGTSKGSGFVAFATPEEA 185

Query: 251 NLVLQNGPHQLDGRTIDPKP 310
              +     QL G+ I+ KP
Sbjct: 186 TEAMS----QLSGKMIESKP 201



 Score = 33.9 bits (74), Expect = 0.081
 Identities = 15/31 (48%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FG YGK+   V+M D  + KS G GF++FE+
Sbjct: 49  FGEYGKITSAVVMKD-GEGKSKGFGFVNFEN 78


>At4g16280.3 68417.m02471 flowering time control protein / FCA gamma
           (FCA) identical to SP|O04425 Flowering time control
           protein FCA {Arabidopsis thaliana}; four alternative
           splice variants, one splicing isoform contains a
           non-consensus CA donor splice site, based on cDNA:
           gi:2204090
          Length = 533

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 2/112 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG +    ++E ++ YF ++G V++  ++K+  +G+ +G  FV +A     +  ++ 
Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180

Query: 269 GPHQ--LDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +Q  L G T  P        ++ + G    K+F+G L    TE ++  IF
Sbjct: 181 LHNQITLPGGT-GPVQVRYADGERERIGTLEFKLFVGSLNKQATEKEVEEIF 231


>At4g16280.2 68417.m02470 flowering time control protein / FCA gamma
           (FCA) identical to SP|O04425 Flowering time control
           protein FCA {Arabidopsis thaliana}; four alternative
           splice variants, one splicing isoform contains a
           non-consensus CA donor splice site, based on cDNA:
           gi:2204090
          Length = 747

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 2/112 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG +    ++E ++ YF ++G V++  ++K+  +G+ +G  FV +A     +  ++ 
Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180

Query: 269 GPHQ--LDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +Q  L G T  P        ++ + G    K+F+G L    TE ++  IF
Sbjct: 181 LHNQITLPGGT-GPVQVRYADGERERIGTLEFKLFVGSLNKQATEKEVEEIF 231


>At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing
           protein low similarity to SP|Q03251 Glycine-rich
           RNA-binding protein 8 (CCR1 protein) {Arabidopsis
           thaliana}; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 181

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 3/103 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P      K KL+V GLS+ T+++ L+  F ++G +I   ++ +  + R +GF F+ +   
Sbjct: 69  PSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETE 128

Query: 242 SLVNLVLQNGPHQ--LDGRTIDPKPCNPRT-LQKPKRGGGYPK 361
                 +Q G H   LDGR I  +    R+ + + K    +PK
Sbjct: 129 EEAMKAIQ-GMHGKFLDGRVIFVEEAKTRSDMSRAKPRRDFPK 170


>At1g49760.1 68414.m05580 polyadenylate-binding protein, putative /
           PABP, putative similar to poly(A)-binding protein
           GB:AAF66825 GI:7673359 from [Nicotiana tabacum]
          Length = 671

 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 26/86 (30%), Positives = 44/86 (51%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           ++ +P  +  +   ++V  LS   S E L + F  +G    CV+M++ E G+S+GFGFV 
Sbjct: 212 LQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGE-GKSKGFGFVN 270

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPK 307
           F +       +      L+G+T D K
Sbjct: 271 FENSDDAARAVD----ALNGKTFDDK 292



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 24/80 (30%), Positives = 41/80 (51%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D  +   L+V  L    + + L+ +F+ +G +  C VM++  SG SRG GFV F+ P   
Sbjct: 322 DKSQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDP-SGVSRGSGFVAFSTPEEA 380

Query: 251 NLVLQNGPHQLDGRTIDPKP 310
              +     +++G+ I  KP
Sbjct: 381 TRAIT----EMNGKMIVTKP 396



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +P +     G +F+  L      + L   FS +G ++ C V  +  SG+S+G+GFV +
Sbjct: 124 DPSLRKSGVGNIFIKNLDKSIDHKALHETFSAFGPILSCKVAVDP-SGQSKGYGFVQY 180



 Score = 35.9 bits (79), Expect = 0.020
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           L+VG L    +   L   F++ G+V+   V ++  + RS G+G+V +A P   +  L   
Sbjct: 47  LYVGDLDATVTDSQLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNEL 106

Query: 269 GPHQLDGRTI 298
               L+GR I
Sbjct: 107 NFMALNGRAI 116


>At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing
           protein low similarity to glycine-rich RNA-binding
           protein [Euphorbia esula] GI:2645699; contains
           INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA
           recognition motif) (RRM) domain
          Length = 337

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 25/77 (32%), Positives = 47/77 (61%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D+   ++VGGL ++ ++E ++R FS YG V+  V + N  S R + +GFVTF++   
Sbjct: 1   MTMDDGNSVYVGGLPYDITEEAVRRVFSIYGSVL-TVKIVNDRSVRGKCYGFVTFSNRRS 59

Query: 248 VNLVLQNGPHQLDGRTI 298
            +  +++    +DG++I
Sbjct: 60  ADDAIED----MDGKSI 72


>At2g36660.1 68415.m04496 polyadenylate-binding protein, putative /
           PABP, putative 
          Length = 609

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           PD   +  G +FV  L    +   LQ  F ++G ++ C V    E G+SRG+GFV F   
Sbjct: 104 PDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKV-ATLEDGKSRGYGFVQFEQE 162

Query: 242 SLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
              +  +Q  N     D      K        KP+    Y  +++  L ++V+E  LR  
Sbjct: 163 DAAHAAIQTLNSTIVADKEIYVGKFMKKTDRVKPEE--KYTNLYMKNLDADVSEDLLREK 220

Query: 416 F 418
           F
Sbjct: 221 F 221



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 17/50 (34%), Positives = 33/50 (66%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           ++V  ++   ++E L+++FS+ G +    +M + E G+S+GFGFV F+ P
Sbjct: 306 IYVKNVNVAVTEEELRKHFSQCGTITSTKLMCD-EKGKSKGFGFVCFSTP 354



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 2/112 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+VG L    ++  L   F+ +  +    + K++ SGRS  +G+  F      NL ++  
Sbjct: 26  LYVGDLHPSVTEGILYDAFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKK 85

Query: 272 PHQ-LDGRTIDPKPCNPRTLQKP-KRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            +  L+G+ I        +++ P  R  G   VF+  LP +VT   L+ +F+
Sbjct: 86  NNSLLNGKMIRVM----WSVRAPDARRNGVGNVFVKNLPESVTNAVLQDMFK 133


>At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing
           protein
          Length = 116

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQN 268
           LFV G+S+ +++E L + FS+YG+V+   V+ +    R +GF +VTF+        +L+ 
Sbjct: 23  LFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLEL 82

Query: 269 GPHQLDGRTI 298
               +DGR +
Sbjct: 83  NAQLVDGRVV 92


>At3g14100.1 68416.m01782 oligouridylate-binding protein, putative
           similar to GB:CAB75429 (GI:6996560) from [Nicotiana
           plumbaginifolia], contains Pfam profiles: PF00076 RNA
           recognition motif (3 copies)
          Length = 427

 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D      +FVG LS E +   L + FS +    D  VM + ++GRSRGFGFV+F
Sbjct: 139 DTSSHFNIFVGDLSPEVTDATLYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSF 192



 Score = 33.1 bits (72), Expect = 0.14
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 6/88 (6%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG L+ E +Q +L RYF   G      V++     R +GFGFV +       L +Q G
Sbjct: 267 VYVGNLAPEVTQLDLHRYFHALG----AGVIEEVRVQRDKGFGFVRYNTHPEAALAIQMG 322

Query: 272 PHQ--LDGRTI----DPKPCNPRTLQKP 337
             Q  L  R I      KP  P T   P
Sbjct: 323 NTQPYLFNRQIKCSWGNKPTPPGTASNP 350


>At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative
          Length = 425

 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 36/131 (27%), Positives = 61/131 (46%), Gaps = 4/131 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E   L++G L +   +  L   FS+ GE++   V++N  +G+  G+GF+ F   +    
Sbjct: 21  EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER 80

Query: 257 VLQ--NGPHQLDGR--TIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
            LQ  NG  Q+ G   T      +  + QK   G  +  +F+G L  +VT+  L+  FR 
Sbjct: 81  TLQTYNGT-QMPGTELTFRLNWASFGSGQKVDAGPDH-SIFVGDLAPDVTDYLLQETFRV 138

Query: 425 LWEGHGGGHYV 457
            +    G   V
Sbjct: 139 HYSSVRGAKVV 149



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           +FVG L+ + +   LQ  F   Y  V    V+ +  +GRS+G+GFV FA+ S
Sbjct: 118 IFVGDLAPDVTDYLLQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAEES 169


>At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative
           DNA binding protein ACBF - Nicotiana tabacum,
           PID:g1899188
          Length = 415

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 15/124 (12%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSR-YGEVIDCVVMKNSESGRSRGFGFVTFADPS--LVNLVL 262
           +FVG L+ + +   L   F   Y  V    V+ +  +GRS+G+GFV FAD S  +  +  
Sbjct: 175 VFVGDLAPDVTDHMLTETFKAVYSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTE 234

Query: 263 QNGPH-----QLDGRTIDPKP--CNPRTLQKPKRGGG-----YPKVFLGGLPSNVTETDL 406
            NG +        G   + KP    P + Q  +   G        +F+G +  +VTE DL
Sbjct: 235 MNGQYCSSRPMRTGPAANKKPLTMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDL 294

Query: 407 RXIF 418
           + +F
Sbjct: 295 KSVF 298



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 9/108 (8%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N    D     +FVG +    ++++L+  F ++GE++   +     +G+    GFV +A+
Sbjct: 269 NSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFGELVHVKI----PAGKR--CGFVQYAN 322

Query: 239 PSLVNLVLQ--NGPHQLDGRTI----DPKPCNPRTLQKPKR---GGGY 355
            +     L   NG  QL G++I       P N +T     +   GGGY
Sbjct: 323 RACAEQALSVLNGT-QLGGQSIRLSWGRSPSNKQTQPDQAQYGGGGGY 369


>At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1
           protein GI:1279562 from [Medicago sativa]
          Length = 557

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 14/124 (11%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           LF   LS+   + +++ +F   GEV+D     N + G  RGFG V FA        L+  
Sbjct: 299 LFAANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEFASSEEAQKALEFH 358

Query: 272 PHQLDGRTI-----------DPKPC-NPRT--LQKPKRGGGYPKVFLGGLPSNVTETDLR 409
              L GR I             +P   P++   +    GG   K+F+ G  ++++E D++
Sbjct: 359 GRPLLGREIRLDIAQERGERGERPAFTPQSGNFRSGGDGGDEKKIFVKGFDASLSEDDIK 418

Query: 410 XIFR 421
              R
Sbjct: 419 NTLR 422



 Score = 31.9 bits (69), Expect = 0.33
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 4/58 (6%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQEN----LQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           DEK K+FV G     S+++    L+ +FS  GE+ +  V  + ++G S+G  ++ F++
Sbjct: 399 DEK-KIFVKGFDASLSEDDIKNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFSE 455


>At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3)
          Length = 660

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 26/80 (32%), Positives = 39/80 (48%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +  +   L++  L      E L+  FS YG V    VM N + G SRGFGFV +++P   
Sbjct: 327 EKSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPEEA 385

Query: 251 NLVLQNGPHQLDGRTIDPKP 310
              L     +++G+ I  KP
Sbjct: 386 LRALS----EMNGKMIGRKP 401



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 32/119 (26%), Positives = 51/119 (42%), Gaps = 7/119 (5%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-------ADP 241
           KG +F+  L      + L   FS +G ++ C V  +  +GRS+G+GFV F       A  
Sbjct: 135 KGNIFIKNLDASIDNKALFETFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAI 193

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +N +L N      G  I  +    R   +      +  V++  LP  + E +LR  F
Sbjct: 194 DKLNGMLMNDKQVFVGHFIRRQ---ERARDENTPTPRFTNVYVKNLPKEIGEDELRKTF 249



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++V  L  E  ++ L++ F ++G +   VVM++ +SG SR FGFV F
Sbjct: 231 VYVKNLPKEIGEDELRKTFGKFGVISSAVVMRD-QSGNSRCFGFVNF 276


>At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative
           similar to gb|U90212 DNA binding protein ACBF from
           Nicotiana tabacum and contains 3 PF|00076 RNA
           recognition motif domains. ESTs gb|T44278, gb|R65195,
           gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278,
           gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1
          Length = 405

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 5/132 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE   L++G L +   +  L   F+  GE++   V++N ++G+  G+GF+ FA  +    
Sbjct: 59  DEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAER 118

Query: 257 VLQ---NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
           VLQ   N P  +          N  +L    +    P   +F+G L ++VT+  L   FR
Sbjct: 119 VLQTFNNAP--IPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDYILLETFR 176

Query: 422 TLWEGHGGGHYV 457
             +    G   V
Sbjct: 177 ASYPSVKGAKVV 188



 Score = 35.9 bits (79), Expect = 0.020
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D     +FVGGL    + ++L+  FS+YGE++   +     +G+    GFV F++ S  
Sbjct: 256 NDPNNTTVFVGGLDASVTDDHLKNVFSQYGEIVHVKI----PAGKR--CGFVQFSEKSCA 309

Query: 251 NLVLQ--NGPHQLDGRTI 298
              L+  NG  QL G T+
Sbjct: 310 EEALRMLNGV-QLGGTTV 326



 Score = 35.1 bits (77), Expect = 0.035
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWE-TSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           DD     +FVG L+ + T    L+ + + Y  V    V+ +  +GR++G+GFV F+D S
Sbjct: 150 DDSPDYTIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDES 208


>At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative
           similar to gb|U90212 DNA binding protein ACBF from
           Nicotiana tabacum and contains 3 PF|00076 RNA
           recognition motif domains. ESTs gb|T44278, gb|R65195,
           gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278,
           gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1
          Length = 306

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 5/132 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE   L++G L +   +  L   F+  GE++   V++N ++G+  G+GF+ FA  +    
Sbjct: 59  DEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAER 118

Query: 257 VLQ---NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
           VLQ   N P  +          N  +L    +    P   +F+G L ++VT+  L   FR
Sbjct: 119 VLQTFNNAP--IPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDYILLETFR 176

Query: 422 TLWEGHGGGHYV 457
             +    G   V
Sbjct: 177 ASYPSVKGAKVV 188



 Score = 35.1 bits (77), Expect = 0.035
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWE-TSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           DD     +FVG L+ + T    L+ + + Y  V    V+ +  +GR++G+GFV F+D S
Sbjct: 150 DDSPDYTIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDES 208



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG 202
           +D     +FVGGL    + ++L+  FS+YGE++   +      G
Sbjct: 256 NDPNNTTVFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCG 299


>At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing
           protein
          Length = 527

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = +2

Query: 62  PDMDDD-EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           P+ D + ++  +F   +  + ++ ++  +FS+ G+V D  ++ +  S RS+G G++ F D
Sbjct: 159 PEADPERDQRTVFAYQMPLKATERDVYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEFYD 218

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPC----NPRTLQKPKRGGGYP---KVFLGGLPSNVTE 397
              V + +        G+ +  KP     N         GG  P   K+++G L  N++E
Sbjct: 219 VMSVPMAIALSGQLFLGQPVMVKPSEAEKNLAQSNSTTVGGTGPADRKLYVGNLHFNMSE 278

Query: 398 TDLRXIF 418
             LR IF
Sbjct: 279 LQLRQIF 285



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVL 262
           KL+VG L +  S+  L++ F  +G V    +  + E+G+ +GFGF+ F   + S    + 
Sbjct: 266 KLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIA 325

Query: 263 QNGPHQLDGRTI 298
            NG  ++ GRTI
Sbjct: 326 LNGKLEIAGRTI 337



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF + GKV +V ++ D+  ++S G G++ F D  S
Sbjct: 187 FFSKAGKVRDVRLIMDRNSRRSKGVGYIEFYDVMS 221


>At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif
          Length = 374

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 5/72 (6%)
 Frame = +2

Query: 65  DMDDDEKG-----KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           D DD E       KLF+ GLS+ TS++ L+  F  +GE+++  ++ +  S RS+G+ F+ 
Sbjct: 270 DQDDSESPPVKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLE 329

Query: 230 FADPSLVNLVLQ 265
           +         L+
Sbjct: 330 YTTEEAAGTALK 341


>At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein GI:1899187 from
           [Nicotiana tabacum]
          Length = 310

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 2/90 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPS-LVNLVLQ 265
           +FVG LS + S   L   FS +Y  V    V+ ++ +GRS+G+GFV F D +     + +
Sbjct: 199 IFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTE 258

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
               +   R +   P  PR     ++ GGY
Sbjct: 259 MNGVKCSSRAMRIGPATPRKTNGYQQQGGY 288


>At1g07350.1 68414.m00783 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to GB:Y09506 from
           [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269
           (1997))
          Length = 382

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V GLS   ++ +L+ +F++ G+V D  ++ +  +  SRGFGF++       N  +++ 
Sbjct: 77  LYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSL 136

Query: 272 PHQ-LDGRTIDPKPCNPRTLQKPKRG 346
            H  L GR I  +    R  + P  G
Sbjct: 137 DHSVLQGRVITVEKARRRRGRTPTPG 162



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 381 HRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           HR   + +   F  + GKV +V ++ D   ++S G GF+S +
Sbjct: 84  HRVTERDLEDHF-AKEGKVTDVHLVLDPWTRESRGFGFISMK 124


>At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing
           protein heterogeneous nuclear ribonucleoprotein R, Homo
           sapiens, PIR:T02673; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 471

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 27/107 (25%), Positives = 51/107 (47%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++++GG+  + ++ +L+ +    GEV +  +M+  +SG  +G+ FVTF    L    +  
Sbjct: 93  EVYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDT 152

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLR 409
               L+      K     T Q   R      +FLG +P N  E+D++
Sbjct: 153 ----LNNTDFRGKRIKCSTTQAKHR------LFLGNVPRNWMESDIK 189


>At3g16380.1 68416.m02074 polyadenylate-binding protein, putative /
           PABP, putative similar to polyadenylate-binding protein
           (poly(A)-binding protein) from {Arabidopsis thaliana}
           SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens}
           SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 537

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 43/81 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  LS   ++  L+  F  YG+++   VM + E+GRS+GFGFV F++        +  
Sbjct: 306 LYVKNLSESMNETRLREIFGCYGQIVSAKVMCH-ENGRSKGFGFVCFSNCE----ESKQA 360

Query: 272 PHQLDGRTIDPKPCNPRTLQK 334
              L+G  +D KP   R  ++
Sbjct: 361 KRYLNGFLVDGKPIVVRVAER 381



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           + +   ++V  L    + + L   FS+YG V   VVM++   GRSRGFGFV F +P
Sbjct: 198 NQDSTNVYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRDG-MGRSRGFGFVNFCNP 252



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 1/112 (0%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVL 262
           G L+VG LS + ++++L   FS    V+   + +NS +G+S  + ++ F  P S  N + 
Sbjct: 21  GSLYVGDLSPDVTEKDLIDKFSLNVPVVSVHLCRNSVTGKSMCYAYINFDSPFSASNAMT 80

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +     L G+ +           + +   G+  +++  L S++T + L  +F
Sbjct: 81  RLNHSDLKGKAMRIMWSQRDLAYRRRTRTGFANLYVKNLDSSITSSCLERMF 132



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V  L    +   L+R F  +G ++ C V++  E+G+S+GFGFV F
Sbjct: 114 LYVKNLDSSITSSCLERMFCPFGSILSCKVVE--ENGQSKGFGFVQF 158



 Score = 27.1 bits (57), Expect = 9.3
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F +YG V  VV+M D    +S G GF++F
Sbjct: 222 FSQYGTVSSVVVMRD-GMGRSRGFGFVNF 249


>At1g54080.1 68414.m06162 oligouridylate-binding protein, putative
           similar to oligouridylate binding protein GI:6996560
           from [Nicotiana plumbaginifolia]
          Length = 426

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 23/54 (42%), Positives = 30/54 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D      +FVG LS E +   L   FS +    D  VM + ++GRSRGFGFV+F
Sbjct: 143 DTSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSF 196



 Score = 30.7 bits (66), Expect = 0.75
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG LS E +Q +L R F   G      V++     R +GFGFV +       L +Q G
Sbjct: 271 VYVGNLSPEVTQLDLHRLFYTLG----AGVIEEVRVQRDKGFGFVRYNTHDEAALAIQMG 326

Query: 272 PHQ 280
             Q
Sbjct: 327 NAQ 329



 Score = 27.5 bits (58), Expect = 7.0
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  +    +  +M+DQ   +S G GF+SF ++
Sbjct: 168 FSAFNSCSDARVMWDQKTGRSRGFGFVSFRNQ 199


>At1g17370.1 68414.m02118 oligouridylate-binding protein, putative
           similar to oligouridylate binding protein [Nicotiana
           plumbaginifolia] GI:6996560; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 419

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D      +FVG LS E +   L   FS Y    D  VM + ++GRSRGFGFV+F
Sbjct: 134 DTSSHFNIFVGDLSPEVTDAMLFTCFSVYPTCSDARVMWDQKTGRSRGFGFVSF 187



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG L+ E SQ +L R+F   G      V++     R +GFGFV ++      L +Q G
Sbjct: 262 VYVGNLAPEVSQVDLHRHFHSLG----AGVIEEVRVQRDKGFGFVRYSTHVEAALAIQMG 317



 Score = 27.1 bits (57), Expect = 9.3
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  Y    +  +M+DQ   +S G GF+SF ++
Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSFRNQ 190


>At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing
           protein low similarity to heterogeneous nuclear
           ribonucleoprotein G [Mus musculus] GI:5579009; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 152

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+ V  L + TS++ L+R FS +GE+ +  ++K+    RS+G+ F+ F       L ++ 
Sbjct: 41  KIMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIET 100

Query: 269 GPHQL-DGRT--IDPKPCNPRTLQKPKRGGGYPK 361
              ++ +GR   ID      R  Q   R  G P+
Sbjct: 101 MDRRMYNGRMIYIDIAKPGKRDFQGLPRTSGPPE 134


>At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing
           protein similar to chloroplast RNA-binding protein cp33
           [Arabidopsis thaliana] GI:681912; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM) domain
          Length = 253

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 20/53 (37%), Positives = 32/53 (60%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           D   K++VG L+   ++E L+  FS  G+V+   V +   + +S GFGFVTF+
Sbjct: 174 DSPYKVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFS 226



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 24/91 (26%), Positives = 42/91 (46%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D   +   ++++G +    + E L +    +G V    VM +  SGRSR FGF T     
Sbjct: 69  DPSSEAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVE 128

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
             N V++    +L+G T++ +       +KP
Sbjct: 129 DANAVVE----KLNGNTVEGREIKVNITEKP 155



 Score = 28.7 bits (61), Expect = 3.0
 Identities = 19/80 (23%), Positives = 33/80 (41%), Gaps = 1/80 (1%)
 Frame = +3

Query: 276 INLMAGPSTLSRAILALFKNRNVAVDT-LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVI 452
           +N+   P   S  +  L    +  VD+  +  +    +T+ K +    F   GKV+   +
Sbjct: 149 VNITEKPIASSPDLSVLQSEDSAFVDSPYKVYVGNLAKTVTKEMLENLFSEKGKVVSAKV 208

Query: 453 MYDQXKKKSXGXGFLSFEDE 512
                  KS G GF++F  E
Sbjct: 209 SRVPGTSKSTGFGFVTFSSE 228


>At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing
           protein 
          Length = 809

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 18/49 (36%), Positives = 32/49 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           ++FVG L    S+E+L++ F   GEV +  ++KN ++ +S+G  F+ FA
Sbjct: 215 EIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFA 263



 Score = 33.5 bits (73), Expect = 0.11
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +F+ GL    ++E ++     YG++    + +N  S R + FGFVTF
Sbjct: 393 IFIDGLLPSWNEERVRDLLKPYGKLEKVELARNMPSARRKDFGFVTF 439



 Score = 29.1 bits (62), Expect = 2.3
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           FG  G+V EV I+ +   KKS G  FL F
Sbjct: 234 FGHVGEVTEVRILKNPQTKKSKGSAFLRF 262


>At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly
           identical to splicing factor RSZ33 [Arabidopsis
           thaliana] GI:9843663; contains Pfam profiles PF00076:
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain),
           PF00098: Zinc knuckle
          Length = 290

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 33/78 (42%), Positives = 40/78 (51%), Gaps = 2/78 (2%)
 Frame = +2

Query: 74  DDEKG--KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           DD  G  +L+VG LS  T   +L+R FSRYG V D V MK       R + FV F DP  
Sbjct: 5   DDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRD-VDMK-------RDYAFVEFGDPRD 56

Query: 248 VNLVLQNGPHQLDGRTID 301
            +    +  H LDGR  D
Sbjct: 57  AD----DARHYLDGRDFD 70


>At2g23350.1 68415.m02788 polyadenylate-binding protein, putative /
           PABP, putative
          Length = 662

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           ++V  LS  T+ + L+  F +YG +   VVM++ + G+SR FGFV F +P
Sbjct: 227 VYVKNLSEATTDDELKTTFGQYGSISSAVVMRDGD-GKSRCFGFVNFENP 275



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 24/73 (32%), Positives = 41/73 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L    + E L+  F+ +G +  C VM++  SG S+G GFV F+  S  + VL   
Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDP-SGTSKGSGFVAFSAASEASRVL--- 385

Query: 272 PHQLDGRTIDPKP 310
            ++++G+ +  KP
Sbjct: 386 -NEMNGKMVGGKP 397



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           G LFV  L      + L   FS  G ++ C V      G+SRG+GFV F          +
Sbjct: 134 GNLFVKNLDKSVDNKTLHEAFSGCGTIVSCKV-ATDHMGQSRGYGFVQFDTEDSA----K 188

Query: 266 NGPHQLDGRTIDPK 307
           N   +L+G+ ++ K
Sbjct: 189 NAIEKLNGKVLNDK 202



 Score = 33.9 bits (74), Expect = 0.081
 Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+VG L +  +   L  YF+   +V+   V +++ +  S G+G+V +++       +Q  
Sbjct: 48  LYVGDLDFNVTDSQLYDYFTEVCQVVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKL 107

Query: 272 PHQ-LDGRTI 298
            +  L+G+ I
Sbjct: 108 NYSYLNGKMI 117



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FG+YG +   V+M D    KS   GF++FE+
Sbjct: 245 FGQYGSISSAVVMRD-GDGKSRCFGFVNFEN 274


>At3g19130.1 68416.m02429 RNA-binding protein, putative similar to
           RNA Binding Protein 47 [Nicotiana plumbaginifolia]
           GI:9663769, DNA binding protein ACBF GB:AAC49850 from
           [Nicotiana tabacum]; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 435

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 34/118 (28%), Positives = 51/118 (43%), Gaps = 4/118 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+   L+VG L     +  L   FS  GEV    V++N  + +S G+GFV F   +    
Sbjct: 105 DDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEE 164

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTL----QKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VLQN    +   +  P   N  +     ++    G    VF+G L  +VT+  L   F
Sbjct: 165 VLQNYSGSVMPNSDQPFRINWASFSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETF 222



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVG LS + +   L   FS RY  V    V+ +S +GRS+G+GFV F D
Sbjct: 204 VFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRFGD 253



 Score = 34.3 bits (75), Expect = 0.061
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVGG+  +   E+L++ FS++GEV+   +         +G GFV FAD
Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPV------GKGCGFVQFAD 365


>At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33)
           nearly identical to SC35-like splicing factor SCL33, 33
           kD [Arabidopsis thaliana] GI:9843659
          Length = 220

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           L V  L  +  QE+L++ F ++G V D  + ++  +G  RGFGFV F DP+
Sbjct: 38  LLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPA 88


>At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 222

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 16/55 (29%), Positives = 33/55 (60%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           L++G +     +  ++ +FS++G V    V +N ++G+S+ FGF+ F DP +  +
Sbjct: 62  LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAEI 116



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FF ++G V  V +  ++   KS   GF+ FED
Sbjct: 79  FFSQFGTVKRVRVARNKKTGKSKHFGFIQFED 110


>At1g34140.1 68414.m04235 polyadenylate-binding protein, putative /
           PABP, putative non-consensus splice donor TA at exon 1;
           similar to polyadenylate-binding protein
           (poly(A)-binding protein) from [Triticum aestivum]
           GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis
           thaliana} SP|P42731; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 407

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVLQ 265
           ++V  L    +  +L+R F  +GE+   VVMK+ E G+SR FGFV F  A+ ++  +   
Sbjct: 121 VYVKNLVETATDADLKRLFGEFGEITSAVVMKDGE-GKSRRFGFVNFEKAEAAVTAIEKM 179

Query: 266 NG 271
           NG
Sbjct: 180 NG 181



 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 1/113 (0%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNLV 259
           +G +FV  L      + L   FS +G+V+ C V +++ SG S+G+GFV F +D S+    
Sbjct: 30  RGNVFVKNLDESIDNKQLCDMFSAFGKVLSCKVARDA-SGVSKGYGFVQFYSDLSVYTAC 88

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    +  + I   P   R      R   +  V++  L    T+ DL+ +F
Sbjct: 89  NFHNGTLIRNQHIHVCPFVSRGQWDKSR--VFTNVYVKNLVETATDADLKRLF 139


>At1g07350.2 68414.m00784 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to GB:Y09506 from
           [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269
           (1997))
          Length = 129

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V GLS   ++ +L+ +F++ G+V D  ++ +  +  SRGFGF++       N  +++ 
Sbjct: 47  LYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSL 106

Query: 272 PHQ-LDGRTI 298
            H  L GR I
Sbjct: 107 DHSVLQGRVI 116



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 381 HRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           HR   + +   F  + GKV +V ++ D   ++S G GF+S +
Sbjct: 54  HRVTERDLEDHF-AKEGKVTDVHLVLDPWTRESRGFGFISMK 94


>At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile: PF01535 PPR repeat
          Length = 952

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 17/60 (28%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK-NSESGRSRGFGFVTFA 235
           NP  +  ++GK+FVG L     +   + +F ++G + + +++K + E  ++ GFGF+ +A
Sbjct: 156 NPQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFGPIENVILIKGHHEVEKNAGFGFIIYA 215


>At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 783

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 16/54 (29%), Positives = 33/54 (61%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           + G+LFV  L +  ++E L  +FS +G++ +  ++ + E+ RSRG  ++ +  P
Sbjct: 259 DTGRLFVRNLPYTATEEELMEHFSTFGKISEVHLVLDKETKRSRGIAYILYLIP 312


>At4g03110.2 68417.m00421 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3
           like factor 3 [Homo sapiens] GI:12746392; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 439

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG L    S+  +Q  FS+YG + D  +++ ++   S+G  F+ +         ++ 
Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQ-TSKGCAFLKYETKEQAVSAMES 165

Query: 266 -NGPHQLDGRTI 298
            NG H+++G T+
Sbjct: 166 INGKHKMEGSTV 177



 Score = 33.5 bits (73), Expect = 0.11
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 4/120 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +++E  KLFVG +    S+  L   F  +  V +  ++K+  +  SRG  F+        
Sbjct: 13  EEEESVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEA 72

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP----KVFLGGLPSNVTETDLRXIF 418
           +  L N  H  + +T+   P     LQ     G       K+F+G LP NV+E +++ +F
Sbjct: 73  D-KLVNACH--NKKTL---PGANSLLQVKYADGELERLEHKLFVGMLPKNVSEAEVQSLF 126


>At4g03110.1 68417.m00420 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3
           like factor 3 [Homo sapiens] GI:12746392; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 441

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG L    S+  +Q  FS+YG + D  +++ ++   S+G  F+ +         ++ 
Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQ-TSKGCAFLKYETKEQAVSAMES 165

Query: 266 -NGPHQLDGRTI 298
            NG H+++G T+
Sbjct: 166 INGKHKMEGSTV 177



 Score = 33.5 bits (73), Expect = 0.11
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 4/120 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +++E  KLFVG +    S+  L   F  +  V +  ++K+  +  SRG  F+        
Sbjct: 13  EEEESVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEA 72

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP----KVFLGGLPSNVTETDLRXIF 418
           +  L N  H  + +T+   P     LQ     G       K+F+G LP NV+E +++ +F
Sbjct: 73  D-KLVNACH--NKKTL---PGANSLLQVKYADGELERLEHKLFVGMLPKNVSEAEVQSLF 126


>At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif
          Length = 177

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 1/90 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           +K  L+VGGL+ E ++  L   F  +G++ D     +  + + R FGFVTF +    +  
Sbjct: 11  QKNTLYVGGLADEVNESILHAAFIPFGDIKDVKTPLDQANQKHRSFGFVTFLEREDASAA 70

Query: 260 LQN-GPHQLDGRTIDPKPCNPRTLQKPKRG 346
           + N    +L GR +      P  ++  ++G
Sbjct: 71  MDNMDGAELYGRVLTVNYALPEKIKGGEQG 100


>At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein
           contains Pfam domain PF00098: Zinc knuckle
          Length = 284

 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 32/78 (41%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +2

Query: 74  DDEKG--KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           DD  G  +L+VG LS  T   +L+R FSRYG V D V MK       R + FV F+DP  
Sbjct: 5   DDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRD-VDMK-------RDYAFVEFSDPRD 56

Query: 248 VNLVLQNGPHQLDGRTID 301
            +    +  + LDGR  D
Sbjct: 57  AD----DARYYLDGRDFD 70


>At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit [Nicotiana plumbaginifolia] GI:3850823
          Length = 565

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 23/88 (26%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           ++FVGGL +  ++  ++     +G +    ++K+ E+G S+G+ F  + D S+ ++    
Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419

Query: 266 -NGPHQLDGRTIDPKPCNPRT-LQKPKR 343
            NG  ++  +T+  +  N  T LQKP++
Sbjct: 420 LNG-IKMGDKTLTVRRANQGTMLQKPEQ 446


>At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit [Nicotiana plumbaginifolia] GI:3850823
          Length = 542

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 23/88 (26%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           ++FVGGL +  ++  ++     +G +    ++K+ E+G S+G+ F  + D S+ ++    
Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419

Query: 266 -NGPHQLDGRTIDPKPCNPRT-LQKPKR 343
            NG  ++  +T+  +  N  T LQKP++
Sbjct: 420 LNG-IKMGDKTLTVRRANQGTMLQKPEQ 446


>At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit [Nicotiana plumbaginifolia] GI:3850823
          Length = 573

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 23/88 (26%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           ++FVGGL +  ++  ++     +G +    ++K+ E+G S+G+ F  + D S+ ++    
Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419

Query: 266 -NGPHQLDGRTIDPKPCNPRT-LQKPKR 343
            NG  ++  +T+  +  N  T LQKP++
Sbjct: 420 LNG-IKMGDKTLTVRRANQGTMLQKPEQ 446


>At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing
           protein similar to ssRNA-binding protein [Dictyostelium
           discoideum] GI:1546894; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 245

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 20/78 (25%), Positives = 45/78 (57%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +LF G L  E + + L + F+R+       V+++  +G+++G+GFV+F +P+ +   L+ 
Sbjct: 138 RLFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSFLNPADLAAALK- 196

Query: 269 GPHQLDGRTIDPKPCNPR 322
              +++G+ +  +P   R
Sbjct: 197 ---EMNGKYVGNRPIKLR 211


>At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit GB:CAA77136 from [Nicotiana plumbaginifolia]
          Length = 589

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 15/56 (26%), Positives = 34/56 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           ++FVGGL +  ++  ++     +G +    ++K+ E+G S+G+ F  + DPS+ ++
Sbjct: 376 RIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDI 431


>At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing
           protein 
          Length = 710

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           LFVG L W T+   L+    +YG V +        SG+S+G+  V F DP   +      
Sbjct: 236 LFVGDLHWWTTDAELEAELCKYGAVKEVKFFDEKASGKSKGYCQVEFYDPVAASAC---- 291

Query: 272 PHQLDGRTIDPKPC 313
              L+G   + +PC
Sbjct: 292 KDALNGYPFNGRPC 305


>At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70
           (U1-70k)
          Length = 427

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 4/110 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  L++E+S+  ++R F  YG +    ++ +  + + +G+ F+ +  
Sbjct: 129 DPNATGDPYKTLFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMH 188

Query: 239 PSLVNLVLQNGPHQ-LDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGG 376
              +    +    Q +DGR +       RT+   +P+R GGG     +GG
Sbjct: 189 TRDMKAAYKQADGQKIDGRRVLVDVERGRTVPNWRPRRLGGGLGTSRVGG 238


>At4g35785.2 68417.m05083 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to transformer-SR
           ribonucleoprotein [Nicotiana tabacum]
           gi|1781299|emb|CAA70700
          Length = 141

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           L+V GLS   + ++L+ +F++ G+V  C ++    +  SRGF FVT +
Sbjct: 74  LYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMS 121


>At4g35785.1 68417.m05082 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to transformer-SR
           ribonucleoprotein [Nicotiana tabacum]
           gi|1781299|emb|CAA70700
          Length = 140

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           L+V GLS   + ++L+ +F++ G+V  C ++    +  SRGF FVT +
Sbjct: 73  LYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMS 120


>At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30)
           nearly identical to SC35-like splicing factor SCL30, 30
           kD [Arabidopsis thaliana] GI:9843657;
           Serine/arginine-rich protein/putative splicing factor,
           Arabidopdis thaliana, EMBL:AF099940; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 262

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           G L V  +  +   E L+  F R+G V D  + ++  SG+ RGF FV F D
Sbjct: 47  GSLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVD 97


>At5g41690.1 68418.m05067 polyadenylate-binding protein, putative /
           PABP, putative similar to poly(A)-binding protein
           GI:7673355 from [Nicotiana tabacum]; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 620

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 22/59 (37%), Positives = 32/59 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           LFV  LS +T   ++  +F+  GEV+   +M N E G+  G+GFV FA        L+N
Sbjct: 246 LFVANLSPQTKISDIFDFFNCVGEVVSIRLMVNHE-GKHVGYGFVEFASADETKKALEN 303



 Score = 35.9 bits (79), Expect = 0.020
 Identities = 21/58 (36%), Positives = 31/58 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           LFV  L +ET   N+  +F + GEV+   ++ N + G+  G GFV FA  +     LQ
Sbjct: 129 LFVANLPYETKIPNIIDFFKKVGEVVRVQLIVNLK-GKLVGCGFVEFASVNEAEEALQ 185



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 20/61 (32%), Positives = 28/61 (45%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K  LFV  LS  T   ++ ++F    EV+   ++ N   G   G GFV FA  +     L
Sbjct: 488 KKTLFVANLSPRTKISHIIKFFKDVAEVVRVRLIVN-HRGEHVGCGFVEFASVNEAQKAL 546

Query: 263 Q 265
           Q
Sbjct: 547 Q 547



 Score = 29.1 bits (62), Expect = 2.3
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           K  LFV  LS +T   ++  +F   GEV+   ++ N  +G+  G  FV F   +   +V
Sbjct: 358 KKTLFVAHLSRKTEITHIINFFKDVGEVVHVRLILN-HTGKHVGCAFVEFGSANEAKMV 415


>At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing
           protein low similarity to Cold-inducible RNA-binding
           protein (Glycine-rich RNA-binding protein CIRP) from
           {Homo sapiens} SP|Q14011, {Rattus norvegicus}
           SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 126

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV G S   S+  L++ FS +G+V +  ++ N  + +S G+G+V F
Sbjct: 60  LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWF 106


>At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing
           protein low similarity to Cold-inducible RNA-binding
           protein (Glycine-rich RNA-binding protein CIRP) from
           {Homo sapiens} SP|Q14011, {Rattus norvegicus}
           SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 172

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV G S   S+  L++ FS +G+V +  ++ N  + +S G+G+V F
Sbjct: 79  LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWF 125


>At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing
           protein low similarity to enhancer binding protein-1;
           EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28
           kDa ribonucleoprotein, chloroplast precursor (28RNP)
           {Nicotiana sylvestris}; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 304

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +2

Query: 62  PDMDDDE--KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           P++ ++E  K +L    + W ++ E+++  F +YG VID + M   +  R+RG  F+  A
Sbjct: 84  PEVVEEEISKTRLIAQNVPWTSTPEDIRSLFEKYGSVID-IEMSMHKKERNRGLVFIEMA 142

Query: 236 DP 241
            P
Sbjct: 143 SP 144


>At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch
           domain-containing protein / RNA recognition motif
           (RRM)-containing protein KIAA0122 gene , Homo sapiens,
           EMBL:HSDKG02; contains Pfam profiles  PF00076: RNA
           recognition motif. (a.k.a. RRM, RBD, or RNP domain),
           PF01585: G-patch domain, weak hit to PF00641: Zn-finger
           in Ran binding protein and others
          Length = 1105

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPH 277
           V GLS ++++E+L +  + +G +    V++   SG SRGF F+ F        ++    H
Sbjct: 302 VKGLSMKSTEEDLYQILAEWGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361

Query: 278 Q---LDGRTI 298
               LDGR +
Sbjct: 362 DGIVLDGRKL 371



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L V GL  +  +E L+  FS++  + D  ++++  +  SRGF FV F
Sbjct: 460 LVVRGLDEDADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHF 506


>At1g71800.1 68414.m08298 cleavage stimulation factor, putative
           similar to cleavage stimulation factor 64 kilodalton
           subunit GB:AAD47839 GI:5713194 from [Drosophila
           melanogaster], SP|P33240 Cleavage stimulation factor, 64
           kDa subunit {Homo sapiens}; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 461

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 3/107 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +FVG + ++ ++E L+      G V+   ++ + E+G+ +G+GF  + D        +N 
Sbjct: 11  VFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNL 70

Query: 269 GPHQLDGR--TIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETD 403
             ++++GR   +D    +  T +   +  G P     GLPS  T T+
Sbjct: 71  QSYEINGRQLRVDFAENDKGTDKTRDQSQGGP-----GLPSTTTVTE 112


>At5g03580.1 68418.m00316 polyadenylate-binding protein, putative /
           PABP, putative similar to poly(A)-binding protein
           [Triticum aestivum] GI:1737492; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 101

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L++  L  + S+E L   FS +G+VI  V+ K+   G SRGF F+ F         + + 
Sbjct: 19  LYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFR-GESRGFAFIEFESADSAGRAMLH- 76

Query: 272 PHQLDGRTIDPK-PCNPRT 325
              +DGR I  K  C  RT
Sbjct: 77  ---MDGRLIGQKILCVQRT 92


>At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 1003

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNL 256
           +K KL +  L ++    +++  FS  G V D  + KN E+G  +GF FV F       N 
Sbjct: 329 QKWKLIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETGLPKGFAFVKFTCKKDAANA 388

Query: 257 VLQNGPHQLDGRTI 298
           + +   H    R I
Sbjct: 389 IKKFNGHMFGKRPI 402



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPS 244
           +DD +  LF+  L ++ ++E +++ F+ +GEV    ++ +  + R  G  FV F  AD S
Sbjct: 556 NDDFERTLFIRNLPFDVTKEEVKQRFTVFGEVESLSLVLHKVTKRPEGTAFVKFKTADAS 615

Query: 245 L 247
           +
Sbjct: 616 V 616


>At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein ACBF GB:U90212 GI:1899187
           from [Nicotiana tabacum]
          Length = 445

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVG L+ + S   L   F+ RY  V    V+ +S +GRS+G+GFV F D
Sbjct: 215 IFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGD 264



 Score = 36.3 bits (80), Expect = 0.015
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGK--LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           N  M D E     +FVGGL  + ++E+L + FS +GEV+   +         +G GFV F
Sbjct: 316 NGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPV------GKGCGFVQF 369

Query: 233 AD 238
           A+
Sbjct: 370 AN 371



 Score = 28.7 bits (61), Expect = 3.0
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F GRY  V    ++ D    +S G GF+ F DE
Sbjct: 233 FAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDE 265


>At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing
           protein 
          Length = 573

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           D+    LFVG L W T+   ++   S+YG V +        SG+S+G+  V F D
Sbjct: 198 DNGNTMLFVGELHWWTTDAEIESVLSQYGRVKEIKFFDERVSGKSKGYCQVEFYD 252


>At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar
           to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome
           associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA
           splicing factor SF3b 49 kDa subunit) {Homo sapiens};
           contains Pfam profile PF00076: RNA recognition motif.
           (a.k.a. RRM, RBD, or RNP domain)
          Length = 363

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVI-DCVVMKNSESGRSRGFGFVTF 232
           D    LF+G L  +  ++ L   FS +G +  +  +M++ ++G SRGFGF+++
Sbjct: 109 DVGANLFIGNLDPDVDEKLLYDTFSAFGVIASNPKIMRDPDTGNSRGFGFISY 161


>At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) family
           protein / RNA recognition motif (RRM)-containing protein
           contains Pfam profiles PF02136: Nuclear transport factor
           2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a.
           RRM, RBD, or RNP domain)
          Length = 428

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 6/102 (5%)
 Frame = +2

Query: 68  MDDDEKG-KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           +D   +G  +FV  L  + + E L   F  +G +    +   S   +   FGFVTFA   
Sbjct: 270 IDQQAEGYTIFVANLLMDATPEQLNETFKGFGAITKDGIQVRSYRLKGNCFGFVTFASAE 329

Query: 245 LVNLVLQ---NGPHQLDGR--TIDPKPCNPRTLQKPKRGGGY 355
            V LVLQ       ++  R  +I+ K  N    +   R GGY
Sbjct: 330 AVKLVLQAHKESAIRIGNRRVSIEEKRGNNDNGRPAMRNGGY 371


>At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing
           protein low similarity to tumor-rejection antigen SART3
           [Mus musculus] GI:7637845; contains INTERPRO:IPR000504
           RNA-binding region RNP-1 (RNA recognition motif) domain
          Length = 817

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 17/80 (21%), Positives = 37/80 (46%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           F+  LS +  +E+++++F   G V    ++ + ++G+ RG  +  F D   +   +    
Sbjct: 654 FISNLSVKAQEEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNR 713

Query: 275 HQLDGRTIDPKPCNPRTLQK 334
               G+ I     NP+  +K
Sbjct: 714 KMFFGKKISIARSNPKKGKK 733


>At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing
           protein low similarity to tumor-rejection antigen SART3
           [Mus musculus] GI:7637845; contains INTERPRO:IPR000504
           RNA-binding region RNP-1 (RNA recognition motif) domain
          Length = 816

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 17/80 (21%), Positives = 37/80 (46%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           F+  LS +  +E+++++F   G V    ++ + ++G+ RG  +  F D   +   +    
Sbjct: 654 FISNLSVKAQEEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNR 713

Query: 275 HQLDGRTIDPKPCNPRTLQK 334
               G+ I     NP+  +K
Sbjct: 714 KMFFGKKISIARSNPKKGKK 733


>At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 674

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 12/55 (21%), Positives = 33/55 (60%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++D     +FV  + +  ++++L R+F+++GEV+   ++ +  +G+  G  ++ F
Sbjct: 510 LEDASSRTIFVANVHFGATKDSLSRHFNKFGEVLKAFIVTDPATGQPSGSAYIEF 564


>At1g03457.1 68414.m00326 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 429

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 4/121 (3%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M+++E+ KLFVG +    ++  L   F  +  V +  ++K   +   RG  F+T      
Sbjct: 6   MENEERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEKTTRAPRGCCFLTCPTRED 65

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP----KVFLGGLPSNVTETDLRXI 415
            + V+ N  H  + +T+ P   +P  LQ     G       K+F+G LP NV+ET+++ +
Sbjct: 66  ADKVI-NSFH--NKKTL-PGASSP--LQVKYADGELERLEHKLFVGMLPKNVSETEVQSL 119

Query: 416 F 418
           F
Sbjct: 120 F 120



 Score = 35.5 bits (78), Expect = 0.026
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           KLFVG L    S+  +Q  FS YG + D  +++ S    S+G  F+ +   + ++  +  
Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQ-TSKGCLFLKYESKEQAVAAMEA 159

Query: 263 QNGPHQLDGRTI 298
            NG H ++G  +
Sbjct: 160 LNGRHIMEGANV 171


>At1g54080.2 68414.m06163 oligouridylate-binding protein, putative
           similar to oligouridylate binding protein GI:6996560
           from [Nicotiana plumbaginifolia]
          Length = 430

 Score = 36.7 bits (81), Expect = 0.011
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVI----DCVVMKNSESGRSRGFGFVTF 232
           D      +FVG LS E +   L   FS +        D  VM + ++GRSRGFGFV+F
Sbjct: 143 DTSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSF 200



 Score = 30.7 bits (66), Expect = 0.75
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG LS E +Q +L R F   G      V++     R +GFGFV +       L +Q G
Sbjct: 275 VYVGNLSPEVTQLDLHRLFYTLG----AGVIEEVRVQRDKGFGFVRYNTHDEAALAIQMG 330

Query: 272 PHQ 280
             Q
Sbjct: 331 NAQ 333


>At5g06000.1 68418.m00665 eukaryotic translation initiation factor
           3G, putative / eIF3g, putative similar to eukaryotic
           translation initiation factor 3g [Arabidopsis thaliana]
           GI:12407751; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 276

 Score = 35.9 bits (79), Expect = 0.020
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++  + V  LS +T   +L   F  +G V  C V  + ++  SRGFGFV+F
Sbjct: 172 DENSVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSF 222


>At3g11400.1 68416.m01390 eukaryotic translation initiation factor
           3G / eIF3g nearly identical to eukaryotic translation
           initiation factor 3g [Arabidopsis thaliana] GI:12407751
          Length = 294

 Score = 35.9 bits (79), Expect = 0.020
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++  + V  LS +T + +L   F  +G V    V  + ++G SRGFGFV F
Sbjct: 210 NDENSVRVTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNF 261


>At1g03457.2 68414.m00327 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 438

 Score = 35.9 bits (79), Expect = 0.020
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--AD 238
           D   + + KLFVG L    S+  +Q  FS YG + D  +++ S    S+G  F+ +   +
Sbjct: 102 DCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQ-TSKGCLFLKYESKE 160

Query: 239 PSLVNLVLQNGPHQLDGRTI 298
            ++  +   NG H ++G  +
Sbjct: 161 QAVAAMEALNGRHIMEGANV 180



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 7/124 (5%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M+++E+ KLFVG +    ++  L   F  +  V +  ++K   +   RG  F+T      
Sbjct: 6   MENEERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEKTTRAPRGCCFLTCPTRED 65

Query: 248 VNLVLQNGPHQ--LDGRT--IDPKPCNPRTLQKPKRG---GGYPKVFLGGLPSNVTETDL 406
            + V+ +  ++  L G +  +  K  +    +            K+F+G LP NV+ET++
Sbjct: 66  ADKVINSFHNKKTLPGASSPLQVKYADGELERLDVLDCSCNPEHKLFVGMLPKNVSETEV 125

Query: 407 RXIF 418
           + +F
Sbjct: 126 QSLF 129


>At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31
           (RSP31) identical to SP|P92964 Arginine/serine-rich
           splicing factor RSP31 {Arabidopsis thaliana}
          Length = 264

 Score = 35.5 bits (78), Expect = 0.026
 Identities = 21/49 (42%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVG   +ET Q +L+R F +YG V D V MK+       G+ FV F D
Sbjct: 4   VFVGNFEYETRQSDLERLFDKYGRV-DRVDMKS-------GYAFVYFED 44


>At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing
           protein KIAA0332 - Homo sapiens, EMBL:AB002330
          Length = 946

 Score = 35.1 bits (77), Expect = 0.035
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVM---KNSESGRSRGFGFVTF 232
           D  D +   L+VG LS +  +  L R F R+G +    +M    + E  R R  GFV+F
Sbjct: 172 DDGDPQTTNLYVGNLSPKVDENFLLRTFGRFGPIASVKIMWPRTDEEKRRQRNCGFVSF 230


>At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein /
           RNA recognition motif (RRM)-containing protein contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM), PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 540

 Score = 34.7 bits (76), Expect = 0.046
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +2

Query: 125 QENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTID 301
           +E++  YFS +G V D  +    +    R FGFVTF  P  V  +L  G PH +    + 
Sbjct: 272 EEDVSNYFSTFGPVQDVRIPYQQK----RMFGFVTFVYPETVKSILAKGNPHFVCDSRVL 327

Query: 302 PKP 310
            KP
Sbjct: 328 VKP 330


>At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein,
           putative
          Length = 506

 Score = 34.7 bits (76), Expect = 0.046
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV  L+  T  E+L   FSR+G V+   V+++ ++G S  + F+ F
Sbjct: 245 LFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEF 291


>At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28)
           nearly identical to SC35-like splicing factor SCL28, 28
           kD [Arabidopsis thaliana] GI:9843655; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 236

 Score = 34.3 bits (75), Expect = 0.061
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGK---LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFG 220
           +R  P   D E      L +  L  +    +L+  F R+G + D  + +N  +G  RGFG
Sbjct: 32  LRERPSSRDHESSGPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFG 91

Query: 221 FVTF 232
           FV +
Sbjct: 92  FVKY 95


>At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 399

 Score = 33.9 bits (74), Expect = 0.081
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 2/105 (1%)
 Frame = +2

Query: 125 QENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTID 301
           +E++  YFS +G V D  +    +    R FGFVTF  P  V  +L  G PH +      
Sbjct: 169 EEDVSDYFSTFGPVQDVRIPYQQK----RMFGFVTFMYPETVKSILAKGNPHFV------ 218

Query: 302 PKPCNPRTLQKP-KRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
              C+ R L KP K  G  P  +      ++ +  L  +++  +E
Sbjct: 219 ---CHSRVLVKPYKEKGKVPDKYRTKPSRDIMDFQLDLLWKRRFE 260


>At1g16610.2 68414.m01990 arginine/serine-rich protein, putative
           (SR45) similar to arginine/serine-rich protein
           GI:6601502 from [Arabidopsis thaliana]
          Length = 407

 Score = 33.9 bits (74), Expect = 0.081
 Identities = 26/96 (27%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF---ADPSLVNLVL 262
           L V  LS   ++ +L+  F  +GEVI   +  +      RG G+V F   AD     L +
Sbjct: 100 LHVDSLSRNVNEAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYM 159

Query: 263 QNGPHQLDGRTIDPK---PCNPRTLQKPKRGGGYPK 361
                Q+DG+ +      P   +    PK     PK
Sbjct: 160 DGA--QIDGKVVKATFTLPPRQKVSSPPKPVSAAPK 193


>At1g16610.1 68414.m01989 arginine/serine-rich protein, putative
           (SR45) similar to arginine/serine-rich protein
           GI:6601502 from [Arabidopsis thaliana]
          Length = 414

 Score = 33.9 bits (74), Expect = 0.081
 Identities = 26/96 (27%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF---ADPSLVNLVL 262
           L V  LS   ++ +L+  F  +GEVI   +  +      RG G+V F   AD     L +
Sbjct: 100 LHVDSLSRNVNEAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYM 159

Query: 263 QNGPHQLDGRTIDPK---PCNPRTLQKPKRGGGYPK 361
                Q+DG+ +      P   +    PK     PK
Sbjct: 160 DGA--QIDGKVVKATFTLPPRQKVSSPPKPVSAAPK 193


>At3g14450.1 68416.m01831 RNA-binding protein, putative contains
           Pfam profile: PF00076 RNA recognition motif. (a.k.a.
           RRM, RBD, or RNP domain) (2 copies)
          Length = 327

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 31/127 (24%), Positives = 53/127 (41%), Gaps = 9/127 (7%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D  +  ++V  +    ++E L   FS  G+V+DC +  +  S     F FV FAD    
Sbjct: 136 EDSIRRTVYVSDIDQSVTEEGLAGLFSNCGQVVDCRICGDPHS--VLRFAFVEFADDQGA 193

Query: 251 NLVLQNGPHQL---DGRTIDPK----PCNPRTL--QKPKRGGGYPKVFLGGLPSNVTETD 403
           +  L  G   L     R +  K    P NP  L   + +R      ++   +   V++ D
Sbjct: 194 HEALSLGGTMLGFYPVRVLPSKTAILPVNPTFLPRSEDEREMCTRTIYCTNIDKKVSQAD 253

Query: 404 LRXIFRT 424
           +R  F +
Sbjct: 254 VRNFFES 260


>At2g05160.1 68415.m00543 zinc finger (CCCH-type) family protein /
           RNA recognition motif (RRM)-containing protein contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 536

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTI 298
           ++ ++  YF+ YG V D  +       + R +GFVTFA    V  +L  G PH +     
Sbjct: 330 TEHDVSIYFTSYGHVEDVRI----PCQQKRMYGFVTFASSETVKHILAKGNPHFI----- 380

Query: 299 DPKPCNPRTLQKPKR 343
               CN R L KP R
Sbjct: 381 ----CNARVLVKPYR 391


>At5g44200.1 68418.m05408 nuclear cap-binding protein, putative
           similar to SP|P52298 20 kDa nuclear cap binding protein
           (CBP20) (NCBP interacting protein 1) {Homo sapiens};
           non-consensus AT donor splice site at exon 4, AC
           acceptor splice site at exon 5; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 257

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++G +S+ T++E L   FSR GE+   ++  +  +    GF FV F
Sbjct: 36  VYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLF 82


>At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 451

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +2

Query: 110 SWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           S   ++E L+  FSR GE+ D V +K    G+SR F ++ F
Sbjct: 11  SKHVTEERLRDVFSRKGEIAD-VKLKRKSDGKSRQFAYIGF 50


>At2g47310.1 68415.m05906 flowering time control protein-related /
           FCA gamma-related 
          Length = 512

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 13/56 (23%), Positives = 30/56 (53%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D  D    KL+V  +S   ++ ++++ F +YG V + ++ K+  +G    + F+ +
Sbjct: 103 DNADGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGERAAYCFIKY 158



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           KL+V  L+ +T++  +   FSRYG +I+ + M   +    RG+ FV F+
Sbjct: 208 KLYVRCLNKQTTKMEVNEVFSRYG-IIEDIYMALDDMKICRGYAFVQFS 255


>At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing
           protein contains Pfam profile:PF00076 RNA recognition
           motif
          Length = 602

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQL-DGRT 295
           + E++  YF  +G V D  +    +    R FGFVTF     V ++L  G PH + D R 
Sbjct: 331 TDEDVSNYFGNFGPVQDVRIPYQQK----RMFGFVTFLHSETVRIILARGNPHFICDSRV 386

Query: 296 -IDPKPCNPRTLQK 334
            + P     R L+K
Sbjct: 387 LVKPYKEKGRILEK 400


>At1g53650.1 68414.m06105 RNA-binding protein, putative similar to
           RNA-binding protein GB:AAA86641 GI:1174153 from
           [Arabidopsis thaliana]
          Length = 314

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 31/135 (22%), Positives = 53/135 (39%), Gaps = 9/135 (6%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G       +D  +  ++V  +    ++E L   FS  G+V+DC +  +  S     F FV
Sbjct: 115 GRASKAQREDSIRRTVYVSDIDQSVTEEGLAGLFSSCGQVVDCRICGDPNS--VLRFAFV 172

Query: 227 TFADPSLVNLVLQNGPHQL---DGRTIDPK----PCNPRTL--QKPKRGGGYPKVFLGGL 379
            F+D       L  G   +     R +  K    P NP  L   + +R      ++   +
Sbjct: 173 EFSDDQGARSALSLGGTMIGYYPVRVLPSKTAILPVNPTFLPRSEDEREMCSRTIYCTNV 232

Query: 380 PSNVTETDLRXIFRT 424
             N TE D+   F++
Sbjct: 233 DKNATEDDVNTFFQS 247


>At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing
           protein Mei2-like protein, Arabidopsis thaliana,
           EMBL:D86122
          Length = 915

 Score = 31.9 bits (69), Expect = 0.33
 Identities = 15/36 (41%), Positives = 16/36 (44%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEV 166
           NP   D  KG L V  L    S + L R    YGEV
Sbjct: 293 NPSQKDTSKGALLVNNLDSSISNQELNRLVKSYGEV 328


>At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-binding
           protein RBP37, Arabidopsis thaliana, PIR:T04196
          Length = 353

 Score = 31.9 bits (69), Expect = 0.33
 Identities = 31/128 (24%), Positives = 53/128 (41%), Gaps = 9/128 (7%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP--- 241
           DD  +  ++V  +  + ++ENL   F   G+V+DC V  +  S     F F+ F +    
Sbjct: 164 DDVIRRTVYVSDIDQQVTEENLAGVFINCGQVVDCRVCGDPNS--VLRFAFIEFTNEEGA 221

Query: 242 ----SLVNLVLQNGPHQLDGRTIDPKPCNPRTL--QKPKRGGGYPKVFLGGLPSNVTETD 403
               S+   VL   P ++        P NP  L   + +R      V+   +   +T+ D
Sbjct: 222 RAALSMSGTVLGFYPLKVLPSKTAIAPVNPTFLPRSEDEREMCVRTVYCTNIDKRITQID 281

Query: 404 LRXIFRTL 427
           L+  F  L
Sbjct: 282 LKGFFEML 289


>At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing
           protein similar to SP|Q14011 Cold-inducible RNA-binding
           protein (Glycine-rich RNA-binding protein CIRP) {Homo
           sapiens}; contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 157

 Score = 31.5 bits (68), Expect = 0.43
 Identities = 15/43 (34%), Positives = 28/43 (65%)
 Frame = +2

Query: 104 GLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           GLS  T+ ++L++ F+ +  +I     K+ ++ R +GFGF+TF
Sbjct: 77  GLSAYTTDQSLRQLFAPFARLI-----KDQQTQRPKGFGFITF 114


>At3g01150.1 68416.m00019 polypyrimidine tract-binding protein,
           putative / heterogeneous nuclear ribonucleoprotein,
           putative similar to Polypyrimidine tract-binding protein
           1 (PTB) (Heterogeneous nuclear ribonucleoprotein I)
           (hnRNP I) from {Sus scrofa} SP|Q29099, {Mus musculus}
           SP|P17225; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 399

 Score = 31.5 bits (68), Expect = 0.43
 Identities = 36/140 (25%), Positives = 59/140 (42%), Gaps = 9/140 (6%)
 Frame = +2

Query: 107 LSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD----PSLVNLVLQNG- 271
           L WE  +E L     R+G++++      S  G +R   FV FAD     S+V+    +  
Sbjct: 24  LPWECVEEELIDLCKRFGKIVN----TKSNVGANRNQAFVEFADLNQAISMVSYYASSSE 79

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP----KVFLGGLPSNVTETDLRXIFRTLWEGH 439
           P Q+ G+T+  +  N   +   +  G  P     V   G+ S+    D   +   ++   
Sbjct: 80  PAQIRGKTVYIQYSNRHEIVNNQSPGDVPGNVLLVTFEGVESHEVSID---VIHLVFSAF 136

Query: 440 GGGHYV*SXEEKVXGFXILV 499
           G  H + +  EK  GF  LV
Sbjct: 137 GFVHKI-ATFEKAAGFQALV 155


>At1g51520.2 68414.m05799 expressed protein contains a weak hit to
           PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 513

 Score = 30.3 bits (65), Expect = 1.00
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQL-DGRT 295
           + E++  YF  +G V D  +    +    R +GFVTFA    V  +L  G PH + D R 
Sbjct: 279 TDEDVSTYFRDFGLVDDVRIPYQQQ----RMYGFVTFAKAETVRTILARGNPHFICDSRV 334

Query: 296 -IDPKPCNPRTLQK 334
            + P     + LQK
Sbjct: 335 LVKPYKEKGKILQK 348


>At1g51520.1 68414.m05798 expressed protein contains a weak hit to
           PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 414

 Score = 30.3 bits (65), Expect = 1.00
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQL-DGRT 295
           + E++  YF  +G V D  +    +    R +GFVTFA    V  +L  G PH + D R 
Sbjct: 279 TDEDVSTYFRDFGLVDDVRIPYQQQ----RMYGFVTFAKAETVRTILARGNPHFICDSRV 334

Query: 296 -IDPKPCNPRTLQK 334
            + P     + LQK
Sbjct: 335 LVKPYKEKGKILQK 348


>At3g50670.2 68416.m05543 U1 small nuclear ribonucleoprotein 70
           (U1-70k)
          Length = 204

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSR 211
           +P+   D    LFV  L++E+S+  ++R F  YG +      ++S +G  R
Sbjct: 129 DPNATGDPYKTLFVSRLNYESSESKIKREFESYGPIKRVGYSEHSLAGSVR 179


>At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing
           protein Mei2-like protein, Arabidopsis thaliana,
           gb:D86122
          Length = 785

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/63 (30%), Positives = 27/63 (42%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP   D  +G L V  L+   S  +L+  F  YGE+ +     N    +   F  V  AD
Sbjct: 213 NPSEKDVNQGTLVVFNLAPSVSNRDLENIFGVYGEIKEIRETPNKRHHKFVEFFDVRSAD 272

Query: 239 PSL 247
            +L
Sbjct: 273 AAL 275


>At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing
           protein low similarity to Cold-inducible RNA-binding
           protein (Glycine-rich RNA-binding protein CIRP) from
           {Homo sapiens} SP|Q14011, {Rattus norvegicus}
           SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 130

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           LFV G S   S+  L++ FS +G+V +      S++ R R    VT
Sbjct: 60  LFVKGFSDSVSEGRLKKVFSEFGQVTNEHYFSGSKNHRKRKDSAVT 105


>At4g10610.1 68417.m01735 RNA-binding protein, putative
          Length = 336

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 9/121 (7%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-------SLV 250
           ++V  +  + ++E L   F  +G+V+DC +  +  S     F F+ F D        +L 
Sbjct: 152 VYVSDIDQQVTEEQLAGLFIGFGQVVDCRICGDPNS--VLRFAFIEFTDEVGARTALNLS 209

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQK--PKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
             +L   P ++        P NP  L +   +R      ++   +   +T+TD++  F +
Sbjct: 210 GTMLGFYPVKVMPSKTAIAPVNPTFLPRTEDEREMCARTIYCTNIDKKLTQTDIKLFFES 269

Query: 425 L 427
           +
Sbjct: 270 V 270


>At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1
           GI:1279563 from [Medicago sativa]
          Length = 335

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 16/65 (24%), Positives = 30/65 (46%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           F   L  +  +  L +YFS +GE+    V  +  +G S G+ ++   + +     L+ G 
Sbjct: 241 FDASLPVDDIKSALSKYFSSFGEITRVFVPPSHGTGGSLGYAYIDLKEGA--EKALELGR 298

Query: 275 HQLDG 289
           H + G
Sbjct: 299 HDVGG 303


>At4g34040.1 68417.m04830 zinc finger (C3HC4-type RING finger)
           family protein similar to Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 666

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 29/82 (35%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Frame = -3

Query: 402 SVSVTFDGSPP-RNTLGYPPPRFGF*RVRGLHGLGSMVLPSS**GPFCSTRLTSEGSANV 226
           S+S+    SP   N  G P PRFG        G G  V  S+    F STR T   S   
Sbjct: 224 SLSMPSQNSPNVNNQSGLPEPRFGL-------GGGRAVTASA----FPSTRSTETISRPG 272

Query: 225 TKPKPLERPDSLFFMTTQSITS 160
            +  P + P+S+ F  TQS +S
Sbjct: 273 RRLNPGQPPESVAFSFTQSGSS 294


>At2g46610.1 68415.m05814 arginine/serine-rich splicing factor,
           putative similar to SP|P92964 Arginine/serine-rich
           splicing factor RSP31 {Arabidopsis thaliana}
          Length = 250

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           ++VG   ++T   +L+R FS++G V   V MK+       G+ FV F D
Sbjct: 4   VYVGNFDYDTRHSDLERLFSKFGRV-KRVDMKS-------GYAFVYFED 44


>At1g05890.1 68414.m00617 zinc finger protein-related contains low
           similarity to zinc finger proteins and Pfam PF01485: IBR
           domain
          Length = 552

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 22/82 (26%), Positives = 34/82 (41%), Gaps = 4/82 (4%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTFADPSLVNLV--LQNGPHQL 283
           E+  E L +   +  EV +     + E    R++  G  +       NLV  L+NG   +
Sbjct: 453 ESGLERLHKCVEKDIEVFELAEGPSEEFNHFRTKLTGLTSITKTFFENLVKALENGLADV 512

Query: 284 DGRTIDPKPCNPRTLQKPKRGG 349
           D +    KP N +   K K GG
Sbjct: 513 DSQAASSKPANSKPSSKTKGGG 534


>At5g20870.1 68418.m02478 glycosyl hydrolase family 17 protein
           similar to elicitor inducible chitinase Nt-SubE76
           GI:11071974 [Nicotiana tabacum]
          Length = 501

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +2

Query: 125 QENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           Q+N+ +Y SRYG  I  V + N    ++    FV    P+L N+
Sbjct: 103 QQNVSQYISRYGTDIRYVAVGNEPFLKTYNNRFVRSTYPALQNV 146


>At5g13620.1 68418.m01578 expressed protein ; expression supported
           by MPSS
          Length = 301

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 11/67 (16%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSR-YGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D++         +  S+  +  YF+R +GE+I+ ++M   E      +  +     +++
Sbjct: 199 EDDRTVFLTFSRGYPLSEAEVHAYFTRRFGEIIEAIIMPGGEGNEQALYAKMVLHSAAMI 258

Query: 251 NLVLQNG 271
             ++ +G
Sbjct: 259 PEIVSDG 265


>At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing
           protein contains INTERPRO:IPR000504 RNA-binding region
           RNP-1 (RNA recognition motif) domain
          Length = 173

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 15/71 (21%), Positives = 33/71 (46%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-- 265
           +++G +    S   L     + G VID  + ++ E+ + +GF F  +    + +  ++  
Sbjct: 9   VYIGNVDERVSDRVLYDIMIQAGRVIDLHIPRDKETDKPKGFAFAEYETEEIADYAVKLF 68

Query: 266 NGPHQLDGRTI 298
           +G   L  RT+
Sbjct: 69  SGLVSLYNRTL 79


>At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 1056

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 10/27 (37%), Positives = 20/27 (74%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVID 172
           L+VGG+    S+++L+  FS++G++ D
Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKIED 278


>At1g32790.1 68414.m04042 RNA-binding protein, putative similar to
           RNA-binding protein GB:CAB40027 GI:4539439 from
           [Arabidopsis thaliana]
          Length = 358

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +D  +  ++V  L  + ++E L   F   G+V+DC +  +  S     F F+ F D
Sbjct: 168 EDVIRRTVYVSDLDQQVTEEQLAGLFVSCGQVVDCRICGDPNS--VLRFAFIEFTD 221


>At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)
           nearly identical to SF2/ASF-like splicing modulator
           Srp30 [Arabidopsis thaliana] GI:4775270
          Length = 268

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           ++VG L  +  +  ++  F +YG ++D + +K     R  G+ FV F DP
Sbjct: 9   IYVGNLPGDIRKCEVEDLFYKYGPIVD-IDLKIPP--RPPGYAFVEFEDP 55


>At5g59950.3 68418.m07518 RNA and export factor-binding protein,
           putative
          Length = 242

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA-DPSLVNLVLQ 265
           KL++  L +    E+++  F+  GE +    +    SGRS+G   V ++     +  V +
Sbjct: 87  KLYISNLDYGVMNEDIKELFAEVGE-LKRYTVHFDRSGRSKGTAEVVYSRRGDALAAVKK 145

Query: 266 NGPHQLDGR 292
               QLDG+
Sbjct: 146 YNDVQLDGK 154


>At5g59950.2 68418.m07519 RNA and export factor-binding protein,
           putative
          Length = 178

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA-DPSLVNLVLQ 265
           KL++  L +    E+++  F+  GE +    +    SGRS+G   V ++     +  V +
Sbjct: 23  KLYISNLDYGVMNEDIKELFAEVGE-LKRYTVHFDRSGRSKGTAEVVYSRRGDALAAVKK 81

Query: 266 NGPHQLDGR 292
               QLDG+
Sbjct: 82  YNDVQLDGK 90


>At5g59950.1 68418.m07517 RNA and export factor-binding protein,
           putative
          Length = 244

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA-DPSLVNLVLQ 265
           KL++  L +    E+++  F+  GE +    +    SGRS+G   V ++     +  V +
Sbjct: 89  KLYISNLDYGVMNEDIKELFAEVGE-LKRYTVHFDRSGRSKGTAEVVYSRRGDALAAVKK 147

Query: 266 NGPHQLDGR 292
               QLDG+
Sbjct: 148 YNDVQLDGK 156


>At5g54210.1 68418.m06753 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 306

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 16/59 (27%), Positives = 26/59 (44%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           M+ N  ++   K +     ++  +S  N   +F RYG  I C    N E  R R F ++
Sbjct: 4   MQQNLSVEPKSKKRKIDSEINNSSSSTNCDHFFVRYG--ICCNCRSNVERHRGRSFDYL 60


>At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 363

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 14/45 (31%), Positives = 26/45 (57%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGR 205
           +D+    L+VGGL+    ++++  +F  YGE+    VM  +E G+
Sbjct: 220 EDESIKTLYVGGLNSRIFEQDIHDHFYAYGEMESIRVM--AEDGK 262


>At4g35030.1 68417.m04969 protein kinase family protein contains
           Pfam domain, PF00069: Protein kinase domain
          Length = 321

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 13/23 (56%), Positives = 14/23 (60%)
 Frame = +3

Query: 228 HLLILHWSTSCYRMDLINLMAGP 296
           HL ILH STSC    +I LM  P
Sbjct: 273 HLDILHRSTSCMEKSVIKLMFTP 295


>At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1
           protein, putative strong similarity to SP|O22315
           Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis
           thaliana}; cDNA NCBI_gi:15810292 supports a truncated
           version while protein evidence supports a longer model.
          Length = 278

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           ++VG L  +  +  ++  FS+YG V+  + +K     R  G+ FV F D
Sbjct: 9   IYVGNLPGDIREREVEDLFSKYGPVVQ-IDLKIPP--RPPGYAFVEFED 54


>At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1
           protein, putative strong similarity to SP|O22315
           Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis
           thaliana}; cDNA NCBI_gi:15810292 supports a truncated
           version while protein evidence supports a longer model.
          Length = 178

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           ++VG L  +  +  ++  FS+YG V+  + +K     R  G+ FV F D
Sbjct: 9   IYVGNLPGDIREREVEDLFSKYGPVVQ-IDLKIPP--RPPGYAFVEFED 54


>At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containing
           protein ESTs gb|F20110 and gb|F20109 come from this
           gene; contains Pfam profile PF00515: TPR Domain
          Length = 1558

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 3/85 (3%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R++   ++D+ G+  + GL  E  +   +  FSR  E    + +K+ E   +  +G+  +
Sbjct: 616 RLHELNEEDDLGQKSIDGLFTELKELLSEEAFSRLKETGTGLHLKSKEELTNMAYGY--Y 673

Query: 233 ADPSLVNLVLQNGPHQL---DGRTI 298
            + +L  LV   G  +L   DGRT+
Sbjct: 674 DEIALPRLVADFGSLELSPVDGRTL 698


>At5g24440.1 68418.m02880 RNA-binding protein, putative
          Length = 320

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 15/56 (26%), Positives = 28/56 (50%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +D  K  ++V  +  + ++E L   F   G+V+DC +  + +S     F F+ F D
Sbjct: 132 EDMIKRTVYVSDIDNQVTEEQLASLFLSCGQVVDCRMCGDYKS--ILRFAFIEFTD 185


>At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing
           protein 
          Length = 90

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVI 169
           +VG L  +T + +L+  FS++G+VI
Sbjct: 11  YVGNLESDTEENDLKNAFSQFGDVI 35


>At1g19600.1 68414.m02441 pfkB-type carbohydrate kinase family
           protein contains Pfam profile: PF00294 pfkB family
           carbohydrate kinase
          Length = 355

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRS 208
           DDE+G+LFV  + +  S  ++ R   + G    CV + +    R+
Sbjct: 100 DDEQGQLFVSNMGF--SGVSISRLRKKKGSTAQCVCLVDDSGNRT 142


>At1g04130.1 68414.m00402 tetratricopeptide repeat (TPR)-containing
           protein contains non-consensus donor splice site AT at
           exon 4 and acceptor splice site at exon5; Contains
           similarity to serine/threonine protein phosphatase
           gb|X83099 from S. cerevisiae, SP|O95801
           Tetratricopeptide repeat protein 4 Homo sapiens;
           contains Pfam profile PF00515: TPR Domain
          Length = 360

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           E   E +++    Y E IDC     S+   S     + F++ S VNL+L N
Sbjct: 36  EEGNECVRKGKKHYSEAIDCYTKAISQGVLSDSETSILFSNRSHVNLLLGN 86


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,523,595
Number of Sequences: 28952
Number of extensions: 273766
Number of successful extensions: 1200
Number of sequences better than 10.0: 209
Number of HSP's better than 10.0 without gapping: 883
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1159
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1161268208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -