BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_G18 (614 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02450.1 68417.m00332 glycine-rich protein similar to several... 71 6e-13 At3g03773.1 68416.m00384 expressed protein 66 2e-11 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 29 2.4 At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to hom... 29 2.4 At4g00120.1 68417.m00012 basic helix-loop-helix (bHLH) family pr... 27 7.5 >At4g02450.1 68417.m00332 glycine-rich protein similar to several proteins containing a tandem repeat region such as Plasmodium falciparum GGM tandem repeat protein (GB:U27807) Length = 241 Score = 70.9 bits (166), Expect = 6e-13 Identities = 39/111 (35%), Positives = 63/111 (56%), Gaps = 2/111 (1%) Frame = +2 Query: 68 PPVLWAQRKEDVFLTFSV-ETKDPTIKIXKDSXY-FTGEGAPDNTLHEVTIALYDTVLPE 241 P V WA+ E +FLT + +TKD + + + + F+ + P+N ++E+ + L D V E Sbjct: 5 PEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADKVNVE 64 Query: 242 KSVFVNXGXCVEMILRKEKTDGPFWPTLTKDKKKPHYLKIDFNKWNDXDDE 394 +S +N G + EK + W L + KK PHY+K+D++KW D DDE Sbjct: 65 ESK-INIGER-SIFCIIEKAEPERWNKLLRVKKPPHYVKVDWDKWVDEDDE 113 >At3g03773.1 68416.m00384 expressed protein Length = 150 Score = 65.7 bits (153), Expect = 2e-11 Identities = 40/127 (31%), Positives = 66/127 (51%), Gaps = 3/127 (2%) Frame = +2 Query: 68 PPVLWAQRKEDVFLTFSV-ETKDPTIKIXKDSXY-FTGEGAPDNTLHEVTIALYDTVLPE 241 P VLWAQR + V+LT ++ + KD ++K + F+ GA E ++ LY ++ E Sbjct: 5 PEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERF-EFSLELYGKIMTE 63 Query: 242 KSVFVNXGXCVEMILRKEKTDGPFWPTLTKDKKKPH-YLKIDFNKWNDXDDEXEXNNSYD 418 V + I ++E++ +W L K ++KP Y+K+D+NKW D D+E + D Sbjct: 64 YRKNVGLRNIIFSIQKEERS---WWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASD 120 Query: 419 FEQMLQN 439 E N Sbjct: 121 DESAFVN 127 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 368 NKWNDXDDEXEXNNSYDFEQMLQN 439 NKW+D E N DFEQ L+N Sbjct: 689 NKWDDKKIEGLKKNKEDFEQQLEN 712 >At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to homeodomain transcription factor (AGL30) GI:3461830 from [Arabidopsis thaliana]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); PMID: 12837945 Length = 389 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 527 QVNXHHQSQFPSHQTKVFXPSAQDHQLHQSSGAFARNH-MNYFXQXHHXHH 378 ++N Q Q Q + PS D + + G F H + F HH HH Sbjct: 307 ELNNLQQQQQQQQQQQQQDPSMYDPMANNNGGCFQIPHDQSMFVNDHHHHH 357 >At4g00120.1 68417.m00012 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 198 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +2 Query: 239 EKSVFVNXGXCVEMILRKEKTDGPFWPTLTKDKKKPHYLKIDFNKWND 382 E ++ G C + K +++ P + + +PH+L +D+NK ND Sbjct: 2 ENGMYKKKGVCDSCVSSKSRSNHS--PKRSMMEPQPHHLLMDWNKAND 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,538,263 Number of Sequences: 28952 Number of extensions: 211150 Number of successful extensions: 610 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -