BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F09 (450 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02450.1 68418.m00171 60S ribosomal protein L36 (RPL36C) 60S ... 86 1e-17 At3g53740.2 68416.m05937 60S ribosomal protein L36 (RPL36B) 60S ... 86 1e-17 At2g37600.1 68415.m04613 60S ribosomal protein L36 (RPL36A) 85 2e-17 At3g53740.1 68416.m05936 60S ribosomal protein L36 (RPL36B) 60S ... 62 1e-10 >At5g02450.1 68418.m00171 60S ribosomal protein L36 (RPL36C) 60S ribosomal protein L36, Arabidopsis thaliana, EMBL:AC004684 Length = 108 Score = 85.8 bits (203), Expect = 1e-17 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +1 Query: 160 RDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 333 R+L++EV G A YEKR ELLKV KDKRALK KR+LGTH RAKRKREE+S+VL +MR Sbjct: 40 RNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 97 >At3g53740.2 68416.m05937 60S ribosomal protein L36 (RPL36B) 60S RIBOSOMAL PROTEIN L36 - Schizosaccharomyces pombe, swissprot:Q92365 Length = 112 Score = 85.8 bits (203), Expect = 1e-17 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +1 Query: 160 RDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 333 R+L++EV G A YEKR ELLKV KDKRALK KR+LGTH RAKRKREE+S+VL +MR Sbjct: 44 RNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101 >At2g37600.1 68415.m04613 60S ribosomal protein L36 (RPL36A) Length = 113 Score = 85.4 bits (202), Expect = 2e-17 Identities = 42/58 (72%), Positives = 47/58 (81%) Frame = +1 Query: 160 RDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 333 R L+REV G A YEKR ELLKV KDKRALK KR+LGTH RAKRKREE+S+VL +MR Sbjct: 44 RKLIREVAGMAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101 >At3g53740.1 68416.m05936 60S ribosomal protein L36 (RPL36B) 60S RIBOSOMAL PROTEIN L36 - Schizosaccharomyces pombe, swissprot:Q92365 Length = 103 Score = 62.5 bits (145), Expect = 1e-10 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = +1 Query: 160 RDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 333 R+L++EV G A YEKR ELLKV+K R+LGTH RAKRKREE+S+VL +MR Sbjct: 44 RNLIKEVAGQAPYEKRITELLKVAK---------RKLGTHKRAKRKREEMSSVLRKMR 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,619,207 Number of Sequences: 28952 Number of extensions: 135859 Number of successful extensions: 363 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -