BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_E21 (501 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19490.1 68416.m02470 sodium hydrogen antiporter, putative si... 31 0.44 At5g48370.1 68418.m05976 thioesterase family protein similar to ... 27 7.1 At3g18020.1 68416.m02290 pentatricopeptide (PPR) repeat-containi... 27 7.1 At3g14680.1 68416.m01857 cytochrome P450, putative similar to GB... 27 7.1 >At3g19490.1 68416.m02470 sodium hydrogen antiporter, putative similar to NhaD [Vibrio parahaemolyticus] gi|3123728|dbj|BAA25994; Na+/H+ aniporter (NhaD) family member, PMID:11500563 Length = 576 Score = 31.1 bits (67), Expect = 0.44 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 7 SPPHSLTGASVAAAKAHVSLSRRPPQEVKLETAS 108 +PPH LT V A + +S+S R PQ V S Sbjct: 11 APPHQLTKRHVIATSSPISISTRLPQNVSFSKVS 44 >At5g48370.1 68418.m05976 thioesterase family protein similar to SP|Q9R0X4 48 kDa acyl-CoA thioester hydrolase, mitochondrial precursor (EC 3.1.2.-) {Mus musculus}; contains Pfam profile PF03061: thioesterase family protein Length = 438 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +2 Query: 224 SEPPTAAAN-VHISRQTK*AASTSFNRTCPETATISIRFEKSTPQIHQEKKTR 379 S+ AN + ++R +K + NR PET + FE++ + + KK R Sbjct: 184 SDSVALTANFIFVARDSKTGKAAPINRLSPETEVEKLLFEEAEARNNLRKKKR 236 >At3g18020.1 68416.m02290 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 688 Score = 27.1 bits (57), Expect = 7.1 Identities = 10/44 (22%), Positives = 24/44 (54%) Frame = -1 Query: 378 RVFFSWWIWGVDFSNRILIVAVSGHVRLNDVDAAHFVCREMWTF 247 +VF + G+ ++ L V + G +++ DV+ + +E+W + Sbjct: 218 KVFDEMRVCGIRPNSLTLSVLIGGFLKMRDVETGRKLMKELWEY 261 >At3g14680.1 68416.m01857 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 512 Score = 27.1 bits (57), Expect = 7.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 411 IVVSKLAFQILRVFFSWWIW 352 I VS + F + V SWW+W Sbjct: 3 ISVSSVTFSLAVVVVSWWVW 22 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.310 0.127 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,124,004 Number of Sequences: 28952 Number of extensions: 107995 Number of successful extensions: 213 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 213 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -