BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0056 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12770.1 68416.m01594 pentatricopeptide (PPR) repeat-containi... 32 0.42 At4g01750.1 68417.m00227 expressed protein T15B16.8 29 2.2 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 29 2.2 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 29 2.2 At1g20790.1 68414.m02603 F-box family protein contains Pfam:PF00... 29 2.2 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 29 3.9 At4g01770.1 68417.m00231 hypothetical protein similar to T15B16.9 29 3.9 At2g32000.1 68415.m03910 DNA topoisomerase family protein simila... 29 3.9 At1g60460.1 68414.m06807 hypothetical protein 29 3.9 At5g02210.1 68418.m00142 expressed protein ; expression supporte... 28 5.1 At1g42700.1 68414.m04928 hypothetical protein 28 5.1 At5g58920.1 68418.m07381 expressed protein 27 9.0 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 27 9.0 At4g26120.1 68417.m03760 ankyrin repeat family protein / BTB/POZ... 27 9.0 At3g62060.1 68416.m06973 pectinacetylesterase family protein sim... 27 9.0 At3g57050.3 68416.m06352 cystathionine beta-lyase, chloroplast /... 27 9.0 At3g57050.2 68416.m06351 cystathionine beta-lyase, chloroplast /... 27 9.0 At3g57050.1 68416.m06350 cystathionine beta-lyase, chloroplast /... 27 9.0 >At3g12770.1 68416.m01594 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 719 Score = 31.9 bits (69), Expect = 0.42 Identities = 35/104 (33%), Positives = 46/104 (44%), Gaps = 14/104 (13%) Frame = -1 Query: 486 IESAHLVFTSLMVVDVFVHGYMD-GIGL----RDG-HLYFFFDLNGIRLFD--FIG---- 343 +E A LVF + DV V M G GL R+ LY + G+ D F+G Sbjct: 374 VEGARLVFDRTLDRDVVVWSAMIVGYGLHGRAREAISLYRAMERGGVHPNDVTFLGLLMA 433 Query: 342 --HWFFDRVRYWFFNNLVDNLINRYMDRLLHCDVDRVGLRYGHL 217 H R +WFFN + D+ IN C +D +G R GHL Sbjct: 434 CNHSGMVREGWWFFNRMADHKINPQQQHYA-CVIDLLG-RAGHL 475 >At4g01750.1 68417.m00227 expressed protein T15B16.8 Length = 367 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 204 PAVREGAHTSTLPGPRHSGATYPCTCL 284 P ++ H+ LP P +G TY C+C+ Sbjct: 222 PQIKPLNHSHDLPAPDQNGETYICSCM 248 >At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 299 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 175 PIPHPVAVSVPQYVKVPIPQPYPVHVTVEQP 267 P P P V+ + V PIP+P P ++ P Sbjct: 130 PTPTPAPVAATETVTTPIPEPVPATISSSTP 160 >At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 419 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 175 PIPHPVAVSVPQYVKVPIPQPYPVHVTVEQP 267 P P P V+ + V PIP+P P ++ P Sbjct: 130 PTPTPAPVAATETVTTPIPEPVPATISSSTP 160 >At1g20790.1 68414.m02603 F-box family protein contains Pfam:PF00646 F-box domain Length = 435 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/31 (29%), Positives = 21/31 (67%) Frame = +1 Query: 145 HVTVVKKIGVPIPHPVAVSVPQYVKVPIPQP 237 H+ + + +P+P P+A+++P + +P+P P Sbjct: 372 HMHMPMPMAMPMPMPIAMAMPMPMPMPMPMP 402 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 127 EHTKPYHVTVVKKIGVPIPHPVAVSVPQYV--KVPIPQPYPVH 249 EH Y +VKK P P PV + P V K P P P PV+ Sbjct: 362 EHPPIYIPPIVKK---PCPPPVPIYKPPVVIPKKPCPPPVPVY 401 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 175 PIPHPVAVSVPQYVKVPIPQPYPVHVTVEQPI 270 P P P + +P ++K P P Y V V P+ Sbjct: 165 PFPLPPPLELPPFLKKPCPPKYSPPVEVPPPV 196 >At4g01770.1 68417.m00231 hypothetical protein similar to T15B16.9 Length = 361 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 204 PAVREGAHTSTLPGPRHSGATYPCTCL 284 P ++ H+ LP P +G TY C+C+ Sbjct: 216 PQIKPLNHSHDLPHPDRNGETYICSCM 242 >At2g32000.1 68415.m03910 DNA topoisomerase family protein similar to DNA topoisomerase III beta-1 (EC 5.99.1.2)(SP:Q9Z321) {Mus musculus} Length = 865 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -2 Query: 155 TVTWYGFVCSVCVWPSGSHSSEGRALASATKRRTTVVLKAIMLP 24 T T G CS+C P+ HS + + + + T+VL + P Sbjct: 711 TKTGAGMPCSLCPHPTCQHSVRNQGVCACPECEGTLVLDPVSFP 754 >At1g60460.1 68414.m06807 hypothetical protein Length = 356 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 254 QWSNLSMYLFIRLSTKLLKNQYRTRSKN 337 +W N Y+ I+++ NQY TR KN Sbjct: 197 EWDNFPSYVQIQIALHWYHNQYPTRQKN 224 >At5g02210.1 68418.m00142 expressed protein ; expression supported by MPSS Length = 161 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +2 Query: 290 LSTKLLKNQYRTRSKNQCPMKSK 358 +S+++LK +YR++ NQ PM+ K Sbjct: 4 ISSRILKPEYRSQYNNQIPMQEK 26 >At1g42700.1 68414.m04928 hypothetical protein Length = 149 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = +2 Query: 287 RLSTKLLKNQYRTRSKNQCPMKSKSLIPLRSKKK*---RCPSLSPIPSMYPCTNTSTTI 454 +L+ K+++N T N P + + +++ RC L P PS + T+TT+ Sbjct: 22 KLAKKIIQNAGDTNGNNSTPNSNDDFAQVFGRERPGRVRCVGLGPTPSSFIQNRTTTTL 80 >At5g58920.1 68418.m07381 expressed protein Length = 162 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 567 GVSSKKSNKFEIRNYLRNTGIQNRDFFVLVLVARTAICKYKI 692 G+ + KS + NYL+ G+ D F V + +C Y I Sbjct: 12 GIEALKS--MDANNYLKKVGLGRDDMFFWKQVGKALLCTYTI 51 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +1 Query: 85 RPSEEWEPEGHTHTEHTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYPVH 249 RP ++ +P + + PY + V K P P PV S P V P P P PVH Sbjct: 489 RPVQKPQPPKES-PQPDDPYDQSPVTKRRSPPPAPVN-SPPPPVYSPPPPPPPVH 541 >At4g26120.1 68417.m03760 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 600 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 162 LHHGHMVRLRVFCVRVAFGLPFFRRPS 82 +H H+ RLR C V G +F+R S Sbjct: 486 IHEKHLSRLRALCKTVELGKRYFKRCS 512 >At3g62060.1 68416.m06973 pectinacetylesterase family protein similar to pectinacetylesterase precursor GI:1431629 from [Vigna radiata]; contains Pfam profile: PF03283 pectinacetylesterase Length = 419 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 375 LNGIRLFDFIGHWFFDRVR 319 LNG R+ + +G W+FDR + Sbjct: 380 LNGKRVAESVGDWYFDRAK 398 >At3g57050.3 68416.m06352 cystathionine beta-lyase, chloroplast / beta-cystathionase / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cystathionase) (Cysteine lyase) {Arabidopsis thaliana} Length = 378 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 247 GPGRVEVWAPSRTAGPTQPPDGESELRSSSPRSHGTASCVLCACGLRAPILQK 89 GP VW S PT P S++R S +H + VL + +P+L + Sbjct: 215 GPQTKLVWLES----PTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSR 263 >At3g57050.2 68416.m06351 cystathionine beta-lyase, chloroplast / beta-cystathionase / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cystathionase) (Cysteine lyase) {Arabidopsis thaliana} Length = 449 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 247 GPGRVEVWAPSRTAGPTQPPDGESELRSSSPRSHGTASCVLCACGLRAPILQK 89 GP VW S PT P S++R S +H + VL + +P+L + Sbjct: 200 GPQTKLVWLES----PTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSR 248 >At3g57050.1 68416.m06350 cystathionine beta-lyase, chloroplast / beta-cystathionase / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cystathionase) (Cysteine lyase) {Arabidopsis thaliana} Length = 464 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 247 GPGRVEVWAPSRTAGPTQPPDGESELRSSSPRSHGTASCVLCACGLRAPILQK 89 GP VW S PT P S++R S +H + VL + +P+L + Sbjct: 215 GPQTKLVWLES----PTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSR 263 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,292,547 Number of Sequences: 28952 Number of extensions: 319818 Number of successful extensions: 975 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -