SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g31955.1 68415.m03903 molybdopterin biosynthesis protein, put...    82   1e-16
At1g68500.1 68414.m07825 expressed protein                             29   1.5  
At2g23380.1 68415.m02792 curly leaf protein (CURLY LEAF) / polyc...    28   2.0  
At4g02020.1 68417.m00272 zeste-like protein 1 (EZA1) identical t...    28   2.6  
At4g24670.2 68417.m03532 alliinase family protein contains Pfam ...    27   4.6  
At4g24670.1 68417.m03531 alliinase family protein contains Pfam ...    27   4.6  
At3g27710.1 68416.m03460 zinc finger protein-related contains si...    27   6.1  
At2g17590.1 68415.m02035 DC1 domain-containing protein contains ...    27   6.1  

>At2g31955.1 68415.m03903 molybdopterin biosynthesis protein,
           putative / molybdenum cofactor biosynthesis enzyme,
           putative 3' fragment; strong similarity to SP|Q39055
           Molybdopterin biosynthesis CNX2 protein (Molybdenum
           cofactor biosynthesis enzyme CNX2) {Arabidopsis
           thaliana}
          Length = 390

 Score = 82.2 bits (194), Expect = 1e-16
 Identities = 38/70 (54%), Positives = 44/70 (62%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR H YLRISLTERCNLRC+YCMP+EGV                + G   +AGV+
Sbjct: 66  LIDKFGRLHTYLRISLTERCNLRCQYCMPSEGVELTPKPQLLSQSEIVRLAGLFVSAGVN 125

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 126 KIRLTGGEPT 135


>At1g68500.1 68414.m07825 expressed protein
          Length = 93

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 164 QPCGGGGLIKRPTWSSTQLP 223
           + C GGG+++  TWSS  LP
Sbjct: 40  EQCWGGGVVEEITWSSVWLP 59


>At2g23380.1 68415.m02792 curly leaf protein (CURLY LEAF) /
           polycomb-group protein identical to polycomb group
           [Arabidopsis thaliana] GI:1903019 (curly leaf); contains
           Pfam profile PF00856: SET domain
          Length = 902

 Score = 28.3 bits (60), Expect = 2.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSCG 333
           C+   AC  K CPC +   CC+ K CG
Sbjct: 655 CNCKIACG-KECPCLLNGTCCE-KYCG 679



 Score = 27.1 bits (57), Expect = 4.6
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = +1

Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342
           A + CR + CPC  A R C    C   W
Sbjct: 694 AKSQCRSRQCPCFAADRECDPDVCRNCW 721


>At4g02020.1 68417.m00272 zeste-like protein 1 (EZA1) identical to
           enhancer of zeste-like protein 1(EZA1) (GI:4185507)
           [Arabidopsis thaliana]; similar to polycomb group
           [Arabidopsis thaliana] GI:1903019 (curly leaf); contains
           Pfam profile PF00856: SET domain
          Length = 856

 Score = 27.9 bits (59), Expect = 2.6
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = +1

Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342
           A + CR + CPC  A R C    C   W
Sbjct: 650 AKSQCRSRQCPCFAAGRECDPDVCRNCW 677


>At4g24670.2 68417.m03532 alliinase family protein contains Pfam
           profiles: PF04864 allinase C-terminal domain, PF04863
           alliinase EGF-like domain
          Length = 440

 Score = 27.1 bits (57), Expect = 4.6
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +1

Query: 172 WRRRPH*ATYMVVDTTTCEYLSLSDATCDAS 264
           W R  + + + VV TT  E  SLS A+C+ S
Sbjct: 39  WDRTAYVSIWPVVSTTASESSSLSSASCNYS 69


>At4g24670.1 68417.m03531 alliinase family protein contains Pfam
           profiles: PF04864 allinase C-terminal domain, PF04863
           alliinase EGF-like domain
          Length = 440

 Score = 27.1 bits (57), Expect = 4.6
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +1

Query: 172 WRRRPH*ATYMVVDTTTCEYLSLSDATCDAS 264
           W R  + + + VV TT  E  SLS A+C+ S
Sbjct: 39  WDRTAYVSIWPVVSTTASESSSLSSASCNYS 69


>At3g27710.1 68416.m03460 zinc finger protein-related contains
           similarity to zinc finger proteins and Pfam domain,
           PF01485: IBR domain
          Length = 537

 Score = 26.6 bits (56), Expect = 6.1
 Identities = 12/28 (42%), Positives = 14/28 (50%)
 Frame = -3

Query: 148 LSGTVIARKHDFIVXRSHSKMRYKDEKL 65
           L G    R H +     HS  RYKDEK+
Sbjct: 308 LCGQATGRDHTYTSIAGHSCGRYKDEKV 335


>At2g17590.1 68415.m02035 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 632

 Score = 26.6 bits (56), Expect = 6.1
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = +3

Query: 60  TNNFSSLYRIFECDLXTIKSCFRAITVPDRLYS 158
           T + SS Y   +C L  +  C+   T+PD+L++
Sbjct: 464 TGSTSSYY--LQCTLCKVFLCYECATIPDKLHN 494


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,291,841
Number of Sequences: 28952
Number of extensions: 162777
Number of successful extensions: 368
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 360
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 367
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 575830496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -