BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov2p23 (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31955.1 68415.m03903 molybdopterin biosynthesis protein, put... 82 1e-16 At1g68500.1 68414.m07825 expressed protein 29 1.5 At2g23380.1 68415.m02792 curly leaf protein (CURLY LEAF) / polyc... 28 2.0 At4g02020.1 68417.m00272 zeste-like protein 1 (EZA1) identical t... 28 2.6 At4g24670.2 68417.m03532 alliinase family protein contains Pfam ... 27 4.6 At4g24670.1 68417.m03531 alliinase family protein contains Pfam ... 27 4.6 At3g27710.1 68416.m03460 zinc finger protein-related contains si... 27 6.1 At2g17590.1 68415.m02035 DC1 domain-containing protein contains ... 27 6.1 >At2g31955.1 68415.m03903 molybdopterin biosynthesis protein, putative / molybdenum cofactor biosynthesis enzyme, putative 3' fragment; strong similarity to SP|Q39055 Molybdopterin biosynthesis CNX2 protein (Molybdenum cofactor biosynthesis enzyme CNX2) {Arabidopsis thaliana} Length = 390 Score = 82.2 bits (194), Expect = 1e-16 Identities = 38/70 (54%), Positives = 44/70 (62%) Frame = +3 Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368 L D GR H YLRISLTERCNLRC+YCMP+EGV + G +AGV+ Sbjct: 66 LIDKFGRLHTYLRISLTERCNLRCQYCMPSEGVELTPKPQLLSQSEIVRLAGLFVSAGVN 125 Query: 369 KLRXTGGEPT 398 K+R TGGEPT Sbjct: 126 KIRLTGGEPT 135 >At1g68500.1 68414.m07825 expressed protein Length = 93 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 164 QPCGGGGLIKRPTWSSTQLP 223 + C GGG+++ TWSS LP Sbjct: 40 EQCWGGGVVEEITWSSVWLP 59 >At2g23380.1 68415.m02792 curly leaf protein (CURLY LEAF) / polycomb-group protein identical to polycomb group [Arabidopsis thaliana] GI:1903019 (curly leaf); contains Pfam profile PF00856: SET domain Length = 902 Score = 28.3 bits (60), Expect = 2.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 253 CDASTACRRKACPCPVAARCCQWKSCG 333 C+ AC K CPC + CC+ K CG Sbjct: 655 CNCKIACG-KECPCLLNGTCCE-KYCG 679 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342 A + CR + CPC A R C C W Sbjct: 694 AKSQCRSRQCPCFAADRECDPDVCRNCW 721 >At4g02020.1 68417.m00272 zeste-like protein 1 (EZA1) identical to enhancer of zeste-like protein 1(EZA1) (GI:4185507) [Arabidopsis thaliana]; similar to polycomb group [Arabidopsis thaliana] GI:1903019 (curly leaf); contains Pfam profile PF00856: SET domain Length = 856 Score = 27.9 bits (59), Expect = 2.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342 A + CR + CPC A R C C W Sbjct: 650 AKSQCRSRQCPCFAAGRECDPDVCRNCW 677 >At4g24670.2 68417.m03532 alliinase family protein contains Pfam profiles: PF04864 allinase C-terminal domain, PF04863 alliinase EGF-like domain Length = 440 Score = 27.1 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 172 WRRRPH*ATYMVVDTTTCEYLSLSDATCDAS 264 W R + + + VV TT E SLS A+C+ S Sbjct: 39 WDRTAYVSIWPVVSTTASESSSLSSASCNYS 69 >At4g24670.1 68417.m03531 alliinase family protein contains Pfam profiles: PF04864 allinase C-terminal domain, PF04863 alliinase EGF-like domain Length = 440 Score = 27.1 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 172 WRRRPH*ATYMVVDTTTCEYLSLSDATCDAS 264 W R + + + VV TT E SLS A+C+ S Sbjct: 39 WDRTAYVSIWPVVSTTASESSSLSSASCNYS 69 >At3g27710.1 68416.m03460 zinc finger protein-related contains similarity to zinc finger proteins and Pfam domain, PF01485: IBR domain Length = 537 Score = 26.6 bits (56), Expect = 6.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 148 LSGTVIARKHDFIVXRSHSKMRYKDEKL 65 L G R H + HS RYKDEK+ Sbjct: 308 LCGQATGRDHTYTSIAGHSCGRYKDEKV 335 >At2g17590.1 68415.m02035 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 632 Score = 26.6 bits (56), Expect = 6.1 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 60 TNNFSSLYRIFECDLXTIKSCFRAITVPDRLYS 158 T + SS Y +C L + C+ T+PD+L++ Sbjct: 464 TGSTSSYY--LQCTLCKVFLCYECATIPDKLHN 494 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,291,841 Number of Sequences: 28952 Number of extensions: 162777 Number of successful extensions: 368 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -