BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d01 (721 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18730.1 68416.m02378 tetratricopeptide repeat (TPR)-containi... 29 2.3 At4g08740.1 68417.m01442 hypothetical protein 28 5.4 At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) simila... 27 9.5 At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) simila... 27 9.5 At1g08170.1 68414.m00902 histone H2B family protein similar to h... 27 9.5 >At3g18730.1 68416.m02378 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 1311 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/71 (25%), Positives = 40/71 (56%) Frame = +2 Query: 398 VYPDKDFSLKLKRVINMFLNDEIENDKIYKLVETVDSSNKLSRRQVDFLIHALLNNVSVT 577 V D ++ ++ I + L+D+ E++ Y+L DSS+K+ R+ + ++ + ++ Sbjct: 583 VVADSQQTVAGRKRIRVILSDD-ESETEYELGCPKDSSHKVLRQNEEVSEESMYFDGAIN 641 Query: 578 FTLHRFVDDNV 610 +T +R + DNV Sbjct: 642 YTDNRAIQDNV 652 >At4g08740.1 68417.m01442 hypothetical protein Length = 213 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/34 (35%), Positives = 24/34 (70%) Frame = -2 Query: 312 KFFIKLDILTSTYYQSIELVFLFKIASSACSISN 211 + F+ +L+S++ S +LVF+ K+ +S+C+ SN Sbjct: 84 QLFLVNKLLSSSWTTSDQLVFVNKLINSSCTTSN 117 >At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 434 RVINMFLNDEIENDKIYKLVETVDSSNKLSRRQVDF 541 +++ +FL+ +++ND YKL V KL+ + V F Sbjct: 149 KIMKVFLDSKLKNDTEYKLETMVGVYRKLTGKDVVF 184 >At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 434 RVINMFLNDEIENDKIYKLVETVDSSNKLSRRQVDF 541 +++ +FL+ +++ND YKL V KL+ + V F Sbjct: 149 KIMKVFLDSKLKNDTEYKLETMVGVYRKLTGKDVVF 184 >At1g08170.1 68414.m00902 histone H2B family protein similar to histone H2B from Chlamydomonas reinhardtii [SP|P54347, SP|P54346, SP|P50565], Volvox carteri [SP|P16867, SP|P16868]; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 243 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 392 EQVYPDKDFSLKLKRVINMFLNDEIE 469 +QV+PD + K V+NMF+ D E Sbjct: 160 KQVHPDLGITSKAMTVVNMFMGDMFE 185 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,109,180 Number of Sequences: 28952 Number of extensions: 233341 Number of successful extensions: 664 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -