SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g41860.2 68415.m05174 calcium-dependent protein kinase, putat...    46   3e-05
At5g39440.1 68418.m04777 Snf1-related protein kinase, putative s...    45   5e-05
At3g01090.2 68416.m00014 Snf1-related protein kinase (KIN10) (SK...    45   7e-05
At3g01090.1 68416.m00013 Snf1-related protein kinase (KIN10) (SK...    45   7e-05
At5g04510.2 68418.m00450 3-phosphoinositide-dependent protein ki...    44   9e-05
At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein ki...    44   9e-05
At3g29160.3 68416.m03654 Snf1-related protein kinase (KIN11) ide...    44   2e-04
At3g29160.2 68416.m03653 Snf1-related protein kinase (KIN11) ide...    44   2e-04
At3g29160.1 68416.m03652 Snf1-related protein kinase (KIN11) ide...    44   2e-04
At2g25090.1 68415.m03002 CBL-interacting protein kinase 16 (CIPK...    43   2e-04
At1g74740.1 68414.m08660 calcium-dependent protein kinase, putat...    43   2e-04
At1g45160.1 68414.m05177 protein kinase family protein contains ...    43   3e-04
At1g30640.1 68414.m03747 protein kinase, putative contains prote...    43   3e-04
At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDP...    43   3e-04
At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4...    42   4e-04
At3g57530.1 68416.m06406 calcium-dependent protein kinase, putat...    42   4e-04
At2g41860.1 68415.m05173 calcium-dependent protein kinase, putat...    42   4e-04
At1g79640.1 68414.m09286 protein kinase family protein contains ...    42   4e-04
At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) /...    42   5e-04
At2g31500.1 68415.m03848 calcium-dependent protein kinase, putat...    42   5e-04
At2g20470.1 68415.m02390 protein kinase, putative contains prote...    42   5e-04
At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein ki...    42   6e-04
At2g19400.1 68415.m02263 protein kinase, putative contains prote...    42   6e-04
At1g70430.1 68414.m08103 protein kinase family protein contains ...    42   6e-04
At1g63700.1 68414.m07209 protein kinase, putative contains prote...    42   6e-04
At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CD...    41   8e-04
At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CD...    41   8e-04
At3g04530.1 68416.m00480 phosphoenolpyruvate carboxylase kinase ...    41   8e-04
At4g24100.1 68417.m03460 protein kinase family protein contains ...    41   0.001
At3g61960.1 68416.m06959 protein kinase family protein contains ...    41   0.001
At3g17850.1 68416.m02275 protein kinase, putative similar to IRE...    41   0.001
At1g53570.2 68414.m06081 mitogen-activated protein kinase kinase...    41   0.001
At1g53570.1 68414.m06080 mitogen-activated protein kinase kinase...    41   0.001
At5g21222.1 68418.m02532 protein kinase family protein contains ...    40   0.001
At1g49180.1 68414.m05514 protein kinase family protein contains ...    40   0.001
At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat...    40   0.002
At4g14350.2 68417.m02211 protein kinase family protein contains ...    40   0.003
At4g14350.1 68417.m02210 protein kinase family protein contains ...    40   0.003
At5g35410.1 68418.m04208 CBL-interacting protein kinase 24 (CIPK...    39   0.003
At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDP...    39   0.003
At5g12480.1 68418.m01466 calmodulin-domain protein kinase isofor...    39   0.003
At5g09890.1 68418.m01143 protein kinase, putative contains prote...    39   0.003
At3g23310.1 68416.m02940 protein kinase, putative contains prote...    39   0.003
At3g23000.1 68416.m02900 CBL-interacting protein kinase 7 (CIPK7...    39   0.003
At4g33080.1 68417.m05678 protein kinase, putative contains prote...    38   0.006
At4g10730.1 68417.m01753 protein kinase family protein contains ...    38   0.006
At1g61950.1 68414.m06988 calcium-dependent protein kinase, putat...    38   0.006
At1g50700.1 68414.m05701 calcium-dependent protein kinase, putat...    38   0.006
At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDP...    38   0.006
At5g57630.1 68418.m07200 CBL-interacting protein kinase 21, puta...    38   0.008
At4g09570.1 68417.m01575 calcium-dependent protein kinase, putat...    38   0.008
At4g04740.1 68417.m00695 calcium-dependent protein kinase, putat...    38   0.008
At2g30360.1 68415.m03695 CBL-interacting protein kinase 11 (CIPK...    38   0.008
At5g19360.1 68418.m02307 calcium-dependent protein kinase, putat...    38   0.010
At4g04720.1 68417.m00693 calcium-dependent protein kinase, putat...    38   0.010
At5g12180.1 68418.m01429 calcium-dependent protein kinase, putat...    37   0.014
At2g45490.1 68415.m05658 protein kinase, putative contains prote...    37   0.014
At2g26980.4 68415.m03240 CBL-interacting protein kinase 3 (CIPK3...    37   0.014
At2g26980.3 68415.m03237 CBL-interacting protein kinase 3 (CIPK3...    37   0.014
At2g26980.2 68415.m03238 CBL-interacting protein kinase 3 (CIPK3...    37   0.014
At2g26980.1 68415.m03239 CBL-interacting protein kinase 3 (CIPK3...    37   0.014
At1g48260.1 68414.m05390 CBL-interacting protein kinase 17 (CIPK...    37   0.014
At5g25110.1 68418.m02975 CBL-interacting protein kinase 25 (CIPK...    37   0.018
At4g24400.1 68417.m03499 CBL-interacting protein kinase 8 (CIPK8...    37   0.018
At1g23700.1 68414.m02992 protein kinase family protein contains ...    37   0.018
At1g08650.1 68414.m00960 phosphoenolpyruvate carboxylase kinase ...    37   0.018
At5g60550.1 68418.m07592 protein kinase family protein contains ...    36   0.024
At5g21326.1 68418.m02534 protein kinase family protein / NAF dom...    36   0.024
At2g17890.1 68415.m02072 calcium-dependent protein kinase family...    36   0.024
At3g51850.1 68416.m05686 calcium-dependent protein kinase, putat...    36   0.032
At3g06230.1 68416.m00716 mitogen-activated protein kinase kinase...    36   0.032
At1g30270.1 68414.m03702 CBL-interacting protein kinase 23 (CIPK...    36   0.032
At1g03920.1 68414.m00377 protein kinase, putative contains prote...    36   0.032
At5g14720.1 68418.m01727 protein kinase family protein contains ...    36   0.042
At3g45240.1 68416.m04882 protein kinase family protein contains ...    36   0.042
At5g58380.1 68418.m07311 CBL-interacting protein kinase 10 (CIPK...    35   0.056
At5g18700.1 68418.m02219 protein kinase-related contains protein...    35   0.056
At4g23650.1 68417.m03405 calcium-dependent protein kinase, putat...    35   0.056
At3g08730.1 68416.m01015 serine/threonine protein kinase (PK1) (...    35   0.056
At3g08720.2 68416.m01014 serine/threonine protein kinase (PK19) ...    35   0.056
At3g08720.1 68416.m01013 serine/threonine protein kinase (PK19) ...    35   0.056
At1g01140.3 68414.m00020 CBL-interacting protein kinase 9 (CIPK9...    35   0.056
At1g01140.2 68414.m00019 CBL-interacting protein kinase 9 (CIPK9...    35   0.056
At1g01140.1 68414.m00018 CBL-interacting protein kinase 9 (CIPK9...    35   0.056
At5g23170.1 68418.m02710 protein kinase family protein contains ...    35   0.073
At5g07070.1 68418.m00800 CBL-interacting protein kinase 2 (CIPK2...    35   0.073
At4g21940.1 68417.m03174 calcium-dependent protein kinase, putat...    35   0.073
At3g20410.1 68416.m02585 calmodulin-domain protein kinase isofor...    35   0.073
At2g23030.1 68415.m02746 protein kinase, putative similar to pro...    35   0.073
At1g50230.1 68414.m05632 protein kinase family protein contains ...    35   0.073
At1g48490.1 68414.m05420 protein kinase, putative similar to inc...    35   0.073
At1g09000.1 68414.m01004 NPK1-related protein kinase, putative (...    35   0.073
At5g56580.1 68418.m07061 mitogen-activated protein kinase kinase...    34   0.097
At5g45820.1 68418.m05635 CBL-interacting protein kinase 20 (CIPK...    34   0.097
At3g21220.1 68416.m02682 mitogen-activated protein kinase kinase...    34   0.097
At2g42630.1 68415.m05276 protein kinase family protein contains ...    34   0.097
At4g32830.1 68417.m04669 protein kinase, putative similar to pro...    34   0.13 
At4g08470.1 68417.m01398 mitogen-activated protein kinase, putat...    34   0.13 
At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ...    34   0.13 
At2g37840.1 68415.m04645 protein kinase family protein contains ...    34   0.13 
At4g18950.1 68417.m02792 ankyrin protein kinase, putative simila...    33   0.17 
At2g46700.1 68415.m05827 calcium-dependent protein kinase, putat...    33   0.17 
At2g41920.1 68415.m05186 protein kinase family protein contains ...    33   0.17 
At2g25880.1 68415.m03106 serine/threonine protein kinase, putati...    33   0.17 
At5g24430.1 68418.m02879 calcium-dependent protein kinase, putat...    33   0.22 
At3g15220.1 68416.m01923 protein kinase, putative similar to ser...    33   0.22 
At3g10660.1 68416.m01282 calcium-dependent protein kinase isofor...    33   0.22 
At2g40860.1 68415.m05044 protein kinase family protein / protein...    33   0.22 
At5g66850.1 68418.m08428 protein kinase family protein contains ...    33   0.30 
At5g10930.1 68418.m01268 CBL-interacting protein kinase 5 (CIPK5...    33   0.30 
At3g58640.2 68416.m06536 protein kinase family protein contains ...    33   0.30 
At3g58640.1 68416.m06535 protein kinase family protein contains ...    33   0.30 
At3g07980.1 68416.m00975 protein kinase, putative similar to MAP...    33   0.30 
At1g18350.1 68414.m02293 mitogen-activated protein kinase kinase...    33   0.30 
At4g40010.1 68417.m05665 serine/threonine protein kinase, putati...    32   0.39 
At4g08500.1 68417.m01401 mitogen-activated protein kinase kinase...    32   0.39 
At3g56760.1 68416.m06313 calcium-dependent protein kinase, putat...    32   0.39 
At3g49370.1 68416.m05397 calcium-dependent protein kinase, putat...    32   0.39 
At1g54960.1 68414.m06277 NPK1-related protein kinase, putative (...    32   0.39 
At1g49580.1 68414.m05559 calcium-dependent protein kinase, putat...    32   0.39 
At1g03740.1 68414.m00354 protein kinase family protein contains ...    32   0.39 
At5g66210.2 68418.m08341 calcium-dependent protein kinase family...    32   0.52 
At5g66210.1 68418.m08340 calcium-dependent protein kinase family...    32   0.52 
At5g63610.1 68418.m07986 protein kinase, putative similar to cyc...    32   0.52 
At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat...    32   0.52 
At3g45790.1 68416.m04955 protein kinase-related contains eukaryo...    32   0.52 
At3g06030.1 68416.m00688 NPK1-related protein kinase, putative (...    32   0.52 
At2g41140.1 68415.m05081 calcium-dependent protein kinase, putat...    32   0.52 
At1g78290.2 68414.m09124 serine/threonine protein kinase, putati...    32   0.52 
At1g78290.1 68414.m09123 serine/threonine protein kinase, putati...    32   0.52 
At1g68830.1 68414.m07870 protein kinase family protein contains ...    32   0.52 
At5g18190.1 68418.m02135 protein kinase family protein contains ...    31   0.68 
At4g36070.1 68417.m05135 calcium-dependent protein kinase family...    31   0.68 
At3g53930.1 68416.m05958 protein kinase family protein contains ...    31   0.68 
At3g46140.1 68416.m04993 protein kinase-related contains eukaryo...    31   0.68 
At3g17510.1 68416.m02237 CBL-interacting protein kinase 1 (CIPK1...    31   0.68 
At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat...    31   0.68 
At4g33950.1 68417.m04818 protein kinase, putative similar to abs...    31   0.90 
At3g13670.1 68416.m01722 protein kinase family protein contains ...    31   0.90 
At1g12580.1 68414.m01461 protein kinase family protein contains ...    31   0.90 
At5g63650.1 68418.m07991 serine/threonine protein kinase, putati...    31   1.2  
At5g55090.1 68418.m06867 protein kinase family protein contains ...    31   1.2  
At5g04870.1 68418.m00510 calcium-dependent protein kinase isofor...    31   1.2  
At4g13020.2 68417.m02032 serine/threonine protein kinase (MHK) i...    31   1.2  
At4g13020.1 68417.m02031 serine/threonine protein kinase (MHK) i...    31   1.2  
At4g12020.1 68417.m01912 protein kinase family protein similar t...    31   1.2  
At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat...    31   1.2  
At1g69220.2 68414.m07926 serine/threonine protein kinase, putati...    31   1.2  
At1g69220.1 68414.m07925 serine/threonine protein kinase, putati...    31   1.2  
At1g53165.1 68414.m06023 protein kinase, putative similar to ser...    31   1.2  
At1g10940.1 68414.m01256 serine/threonine protein kinase, putati...    31   1.2  
At5g66880.1 68418.m08431 serine/threonine protein kinase, putati...    30   1.6  
At5g08590.1 68418.m01022 serine/threonine protein kinase (ASK2) ...    30   1.6  
At4g35780.1 68417.m05080 protein kinase family protein similar t...    30   1.6  
At4g04700.1 68417.m00690 calcium-dependent protein kinase, putat...    30   1.6  
At3g50530.1 68416.m05526 calcium-dependent protein kinase, putat...    30   1.6  
At2g40580.1 68415.m05006 protein kinase family protein contains ...    30   1.6  
At2g40560.1 68415.m05004 protein kinase family protein contains ...    30   1.6  
At1g60940.2 68414.m06860 serine/threonine protein kinase, putati...    30   1.6  
At1g60940.1 68414.m06859 serine/threonine protein kinase, putati...    30   1.6  
At1g51660.1 68414.m05820 mitogen-activated protein kinase kinase...    30   1.6  
At3g50500.1 68416.m05523 protein kinase, putative similar to abs...    30   2.1  
At3g03940.1 68416.m00412 protein kinase family protein contains ...    30   2.1  
At4g26890.1 68417.m03869 protein kinase family protein contains ...    29   2.8  
At4g22940.1 68417.m03312 protein kinase family protein contains ...    29   2.8  
At4g21370.1 68417.m03088 S-locus protein kinase, putative simila...    29   2.8  
At2g41930.1 68415.m05187 protein kinase family protein contains ...    29   2.8  
At2g34290.1 68415.m04195 protein kinase family protein contains ...    29   2.8  
At2g31010.1 68415.m03781 protein kinase family protein contains ...    29   2.8  
At1g54610.1 68414.m06228 protein kinase family protein contains ...    29   2.8  
At3g45640.1 68416.m04929 mitogen-activated protein kinase, putat...    29   3.7  
At3g17750.1 68416.m02265 protein kinase family protein contains ...    29   3.7  
At2g23080.2 68415.m02751 casein kinase II alpha chain, putative ...    29   3.7  
At2g23080.1 68415.m02752 casein kinase II alpha chain, putative ...    29   3.7  
At1g37130.1 68414.m04639 nitrate reductase 2 (NR2) identical to ...    29   3.7  
At1g20930.1 68414.m02621 cell division control protein, putative...    29   3.7  
At5g27790.1 68418.m03332 protein kinase family protein contains ...    29   4.8  
At4g38470.1 68417.m05436 protein kinase family protein similar t...    29   4.8  
At3g54180.1 68416.m05989 cell division control protein 2 homolog...    29   4.8  
At1g76540.1 68414.m08907 cell division control protein, putative...    29   4.8  
At5g41990.1 68418.m05112 protein kinase family protein contains ...    28   6.4  
At5g12090.1 68418.m01420 protein kinase family protein contains ...    28   6.4  
At5g05160.1 68418.m00549 leucine-rich repeat transmembrane prote...    28   6.4  
At3g59790.1 68416.m06672 mitogen-activated protein kinase, putat...    28   6.4  
At3g17510.2 68416.m02236 CBL-interacting protein kinase 1 (CIPK1...    28   6.4  
At2g18170.1 68415.m02114 mitogen-activated protein kinase, putat...    28   6.4  
At1g28570.2 68414.m03518 GDSL-motif lipase, putative similar to ...    28   6.4  
At2g25760.2 68415.m03092 protein kinase family protein contains ...    28   8.4  
At2g25760.1 68415.m03091 protein kinase family protein contains ...    28   8.4  
At2g17170.1 68415.m01983 protein kinase family protein contains ...    28   8.4  

>At2g41860.2 68415.m05174 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 7 [Arabidopsis thaliana]
           gi|1399277|gb|AAB03247
          Length = 530

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 18/79 (22%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + M +HPN + +   +       +VM+  +  +LF+ +  +G  + +  +++I+ 
Sbjct: 102 EVEIMRQMPEHPNIVTLKETYEDDKAVHLVMELCEGGELFDRIVARGHYTERAAASVIKT 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   HKH  +H D+K
Sbjct: 162 IIEVVQMCHKHGVMHRDLK 180


>At5g39440.1 68418.m04777 Snf1-related protein kinase, putative
           similar to SNF1-related protein kinase KIN10 (EC
           2.7.1.-) (AKIN10) [Arabidopsis thaliana]
           SWISS-PROT:Q38997
          Length = 494

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = -3

Query: 265 NFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELS 89
           N G    V  EIK+ + +  HP+ I+ Y      N+  +VM+Y+   +LF+ +  KG+L 
Sbjct: 57  NMGIEIKVQREIKILRFLM-HPHIIRQYEVIETPNDIYVVMEYVKSGELFDYIVEKGKLQ 115

Query: 88  HQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
                ++ +Q+   +   H++  +H D+K
Sbjct: 116 EDEARHLFQQIISGVEYCHRNMIVHRDLK 144


>At3g01090.2 68416.m00014 Snf1-related protein kinase (KIN10)
           (SKIN10) identical to Snf1-related protein kinase, KIN10
           SP:Q38997 from [Arabidopsis thaliana]
          Length = 535

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I++Y       +  +VM+Y++  +LF+ +  KG L      N  +Q
Sbjct: 90  EIKILRLFM-HPHIIRLYEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQ 148

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 149 IISGVEYCHRNMVVHRDLK 167


>At3g01090.1 68416.m00013 Snf1-related protein kinase (KIN10)
           (SKIN10) identical to Snf1-related protein kinase, KIN10
           SP:Q38997 from [Arabidopsis thaliana]
          Length = 512

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I++Y       +  +VM+Y++  +LF+ +  KG L      N  +Q
Sbjct: 67  EIKILRLFM-HPHIIRLYEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 126 IISGVEYCHRNMVVHRDLK 144


>At5g04510.2 68418.m00450 3-phosphoinositide-dependent protein
           kinase, putative similar to 3-phosphoinositide-dependent
           protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166
          Length = 408

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 25/90 (27%), Positives = 44/90 (48%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           + N  A   ++ I + QL  +HP  IK+YF     ++  + ++  +  +LF+ +  KG L
Sbjct: 82  KENKTAYVKLERIVLDQL--EHPGIIKLYFTFQDTSSLYMALESCEGGELFDQITRKGRL 139

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           S         ++ +AL  +H    IH DIK
Sbjct: 140 SEDEARFYTAEVVDALEYIHSMGLIHRDIK 169


>At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein
           kinase, putative similar to 3-phosphoinositide-dependent
           protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166
          Length = 491

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 25/90 (27%), Positives = 44/90 (48%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           + N  A   ++ I + QL  +HP  IK+YF     ++  + ++  +  +LF+ +  KG L
Sbjct: 82  KENKTAYVKLERIVLDQL--EHPGIIKLYFTFQDTSSLYMALESCEGGELFDQITRKGRL 139

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           S         ++ +AL  +H    IH DIK
Sbjct: 140 SEDEARFYTAEVVDALEYIHSMGLIHRDIK 169


>At3g29160.3 68416.m03654 Snf1-related protein kinase (KIN11)
           identical to protein kinase AKin11 GI:1729444 from
           [Arabidopsis thaliana]
          Length = 359

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/79 (27%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I+ Y      ++  +VM+Y+   +LF+ +  KG L      N  +Q
Sbjct: 68  EIKILRLFM-HPHIIRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQ 126

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 127 IISGVEYCHRNMVVHRDLK 145


>At3g29160.2 68416.m03653 Snf1-related protein kinase (KIN11)
           identical to protein kinase AKin11 GI:1729444 from
           [Arabidopsis thaliana]
          Length = 512

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/79 (27%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I+ Y      ++  +VM+Y+   +LF+ +  KG L      N  +Q
Sbjct: 68  EIKILRLFM-HPHIIRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQ 126

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 127 IISGVEYCHRNMVVHRDLK 145


>At3g29160.1 68416.m03652 Snf1-related protein kinase (KIN11)
           identical to protein kinase AKin11 GI:1729444 from
           [Arabidopsis thaliana]
          Length = 512

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/79 (27%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I+ Y      ++  +VM+Y+   +LF+ +  KG L      N  +Q
Sbjct: 68  EIKILRLFM-HPHIIRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQ 126

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 127 IISGVEYCHRNMVVHRDLK 145


>At2g25090.1 68415.m03002 CBL-interacting protein kinase 16 (CIPK16)
           identical to CBL-interacting protein kinase 16
           [Arabidopsis thaliana] gi|14009298|gb|AAK50348
          Length = 469

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI V +L+  HPN +++            VM+Y++  +LFE +   G+L   L     +Q
Sbjct: 64  EIAVMRLLR-HPNVVELREVMATKKKIFFVMEYVNGGELFEMIDRDGKLPEDLARKYFQQ 122

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H DIK
Sbjct: 123 LISAVDFCHSRGVFHRDIK 141


>At1g74740.1 68414.m08660 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 541

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/79 (21%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ +   + +HPN +K+   +    N  +VM+  +  +LF+ +  +G  + +  + + R 
Sbjct: 107 EVTIMSTLPEHPNVVKLKATYEDNENVHLVMELCEGGELFDRIVARGHYTERAAATVART 166

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   H +  +H D+K
Sbjct: 167 IAEVVRMCHVNGVMHRDLK 185


>At1g45160.1 68414.m05177 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 1067

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/69 (28%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           +P  ++ +++    +N  +VM+Y++  DL+  LQ  G L  ++    I +L  AL  LH 
Sbjct: 727 YPFLVRFFYSFTCRDNLYLVMEYLNGGDLYSLLQKVGCLDEEIARIYIAELVLALEYLHS 786

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 787 LKIVHRDLK 795


>At1g30640.1 68414.m03747 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069
          Length = 562

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/70 (27%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D P  +K+ ++     +  ++M+Y+   D+   L  K  L        + Q   A+  +H
Sbjct: 176 DSPFIVKLCYSFQDDEHLYLIMEYLPGGDMMTLLMRKDTLREDETRFYVAQTILAIESIH 235

Query: 31  KHNFIHNDIK 2
           KHN++H DIK
Sbjct: 236 KHNYVHRDIK 245


>At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDPK1)
           identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 545

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 17/79 (21%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ +   + +HPN +K+  ++    N  +VM+  +  +LF+ +  +G  + +  + + R 
Sbjct: 111 EVAIMSTLPEHPNVVKLKASYEDNENVHLVMELCEGGELFDRIVARGHYTERAAAAVART 170

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   H +  +H D+K
Sbjct: 171 IAEVVMMCHSNGVMHRDLK 189


>At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4)
           identical to CBL-interacting protein kinase 4
           [Arabidopsis thaliana] gi|13249503|gb|AAG01367;
           identical to cDNA calcineurin B-like (CBL) interacting
           protein kinase 4 (CIPK4) GI:13249502
          Length = 426

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 22/81 (27%), Positives = 40/81 (49%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           + EI+  + +++HPN +KI+      +   +V++Y    +LF  L   G L+        
Sbjct: 67  IREIEAMRRLHNHPNVLKIHEVMATKSKIYLVVEYAAGGELFTKLIRFGRLNESAARRYF 126

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +QL  AL+  H+    H D+K
Sbjct: 127 QQLASALSFCHRDGIAHRDVK 147


>At3g57530.1 68416.m06406 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 7 [Arabidopsis thaliana]
           gi|1399277|gb|AAB03247
          Length = 538

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 17/79 (21%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + M +HPN + +   +   +   +VM+  +  +LF+ +  +G  + +  + + + 
Sbjct: 111 EVEIMRHMPEHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKT 170

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   HKH  +H D+K
Sbjct: 171 IMEVVQVCHKHGVMHRDLK 189


>At2g41860.1 68415.m05173 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 7 [Arabidopsis thaliana]
           gi|1399277|gb|AAB03247
          Length = 425

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 17/72 (23%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           M +HPN + +   +       +VM+  +  +LF+ +  +G  + +  +++I+ + E +  
Sbjct: 4   MPEHPNIVTLKETYEDDKAVHLVMELCEGGELFDRIVARGHYTERAAASVIKTIIEVVQM 63

Query: 37  LHKHNFIHNDIK 2
            HKH  +H D+K
Sbjct: 64  CHKHGVMHRDLK 75


>At1g79640.1 68414.m09286 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 694

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = -3

Query: 277 FAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYID---CPDLFETLQ 107
           F  +N   N N+       ++ DHPN +K + +    +N  ++M Y+    C  + +   
Sbjct: 46  FERDNCDLN-NISREAQTMMLVDHPNVLKSHCSFVSDHNLWVIMPYMSGGSCLHILKAAY 104

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             G     +++ I+R+  + L+ LH+H  IH D+K
Sbjct: 105 PDG-FEEAIIATILREALKGLDYLHQHGHIHRDVK 138


>At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) /
            protein kinase, putative nearly identical to IRE
            (incomplete root hair elongation) [Arabidopsis thaliana]
            gi|6729346|dbj|BAA89783
          Length = 1168

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            +P  ++ +++     N  +VM+Y++  DLF  L+  G L   +    I ++  AL  LH 
Sbjct: 811  NPFVVRFFYSFTCRENLYLVMEYLNGGDLFSLLRNLGCLDEDMARIYIAEVVLALEYLHS 870

Query: 28   HNFIHNDIK 2
             N IH D+K
Sbjct: 871  VNIIHRDLK 879


>At2g31500.1 68415.m03848 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 582

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 18/81 (22%), Positives = 42/81 (51%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNII 65
           E+++ + +  HPN +   F   F +   +  VM+  +  +LF+ +  +G  + +  +++ 
Sbjct: 114 EVEIMRCLPKHPNIVS--FKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVA 171

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           + + E +   H+H  IH D+K
Sbjct: 172 KTILEVVKVCHEHGVIHRDLK 192


>At2g20470.1 68415.m02390 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069
          Length = 596

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 19/70 (27%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D    +K+Y +    ++  +VM+Y+   D+   L  K  L+ +     + +   A+  +H
Sbjct: 180 DSNYIVKLYCSFQDDDHLYLVMEYLPGGDMMTLLMRKDTLTEEEAKFYVAETVLAIESIH 239

Query: 31  KHNFIHNDIK 2
           +HN+IH DIK
Sbjct: 240 RHNYIHRDIK 249


>At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein
           kinase, putative similar to 3-phosphoinositide-dependent
           protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166
          Length = 486

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 23/90 (25%), Positives = 43/90 (47%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           + N  A   ++ I + QL  +HP  +K++F      +  + ++  +  +LF+ +  KG L
Sbjct: 83  KENKTAYVKLERIVLDQL--EHPGIVKLFFTFQDTQSLYMALESCEGGELFDQITRKGRL 140

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           S         ++ +AL  +H    IH DIK
Sbjct: 141 SEDEARFYSAEVVDALEYIHNMGLIHRDIK 170


>At2g19400.1 68415.m02263 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069
          Length = 527

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/65 (27%), Positives = 34/65 (52%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++        ++M+Y+   D+   L  +  L+  +    I Q   A+  +HKHN++
Sbjct: 166 VKLYYSFQDPEYLYLIMEYLSGGDVMTLLMREETLTETVARFYIAQSVLAIESIHKHNYV 225

Query: 16  HNDIK 2
           H DIK
Sbjct: 226 HRDIK 230


>At1g70430.1 68414.m08103 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 594

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYID---CPDLFETLQIKGELSHQLVSNI 68
           E+ +  L+ DHPN +K + +    ++  IVM Y+    C  L +++  +G L   +++ +
Sbjct: 62  EVHIMSLI-DHPNLLKAHCSFIDSSSLWIVMPYMSGGSCFHLMKSVYPEG-LEQPIIATL 119

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +R++ +AL  LH+   IH D+K
Sbjct: 120 LREVLKALVYLHRQGHIHRDVK 141


>At1g63700.1 68414.m07209 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069; similar to MEK kinase
           (MAP3Ka) [Arabidopsis thaliana] gi|4204912|gb|AAD10848
          Length = 883

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N ++ Y +    +   I ++Y+    +++ LQ  G+     + N  +Q+   L  LH 
Sbjct: 459 HQNIVQYYGSETVDDKLYIYLEYVSGGSIYKLLQEYGQFGENAIRNYTQQILSGLAYLHA 518

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 519 KNTVHRDIK 527


>At5g19450.2 68418.m02318 calcium-dependent protein kinase 19
           (CDPK19) identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|836942|gb|AAA67655
          Length = 533

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 18/79 (22%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + M  HPN + +       +   IVM+  +  +LF+ +  +G  + +  + +++ 
Sbjct: 105 EVEIMKHMPRHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKT 164

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   HKH  +H D+K
Sbjct: 165 ILEVVQICHKHGVMHRDLK 183


>At5g19450.1 68418.m02317 calcium-dependent protein kinase 19
           (CDPK19) identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|836942|gb|AAA67655
          Length = 533

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 18/79 (22%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + M  HPN + +       +   IVM+  +  +LF+ +  +G  + +  + +++ 
Sbjct: 105 EVEIMKHMPRHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKT 164

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   HKH  +H D+K
Sbjct: 165 ILEVVQICHKHGVMHRDLK 183


>At3g04530.1 68416.m00480 phosphoenolpyruvate carboxylase kinase 2
           (PPCK2) phosphoenolpyruvate carboxylase kinase 2
           [Arabidopsis thaliana] gi|13877128|gb|AAK43710; contains
           protein kinase domain, Pfam:PF00069
          Length = 278

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP-DLFETL-QIKGELSHQLVSNII 65
           E ++  ++  HPN I+I+  +   ++  IVM+ +D P  +++ L    G LS    ++  
Sbjct: 59  EPRIMAMLPPHPNIIRIFDLYETEDSLAIVMELVDPPMTIYDRLISAGGRLSESESASYA 118

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+  AL   H+ + +H D+K
Sbjct: 119 KQILSALAHCHRCDVVHRDVK 139


>At4g24100.1 68417.m03460 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 709

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 6/90 (6%)
 Frame = -3

Query: 253 NFNVDEIKVH-QLMN--DHPNFIKIYFNHGFINNQVIVMDYI---DCPDLFETLQIKGEL 92
           N N+D+I+   Q M+  DHPN IK + +    ++  +VM ++    C  L +T    G  
Sbjct: 70  NSNLDDIRRESQTMSLIDHPNVIKSFCSFSVDHSLWVVMPFMAQGSCLHLMKTAYSDG-F 128

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
               +  ++++  +AL+ LH+   IH D+K
Sbjct: 129 EESAICCVLKETLKALDYLHRQGHIHRDVK 158


>At3g61960.1 68416.m06959 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 626

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 21/70 (30%), Positives = 35/70 (50%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN I+ Y      +   +V++Y    DL   +   G++   +  + +RQL   L  L 
Sbjct: 65  DHPNIIRFYEAIETGDRIFLVLEYCSGGDLAGYINRHGKVPEAVAKHFMRQLALGLQVLQ 124

Query: 31  KHNFIHNDIK 2
           + +FIH D+K
Sbjct: 125 EKHFIHRDLK 134


>At3g17850.1 68416.m02275 protein kinase, putative similar to IRE
            (incomplete root hair elongation) [Arabidopsis thaliana]
            gi|6729346|dbj|BAA89783; contains protein kinase domain
            Pfam:PF00069
          Length = 1296

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            +P  ++ +++    +N  +VM+Y++  DL+  L+  G L   +V   I ++  AL  LH 
Sbjct: 939  NPFVVRFFYSFTCRDNLYLVMEYLNGGDLYSLLRNLGCLEEDIVRVYIAEVVLALEYLHS 998

Query: 28   HNFIHNDIK 2
               +H D+K
Sbjct: 999  EGVVHRDLK 1007


>At1g53570.2 68414.m06081 mitogen-activated protein kinase kinase
           kinase (MAPKKK), putative (MAP3Ka) identical to MEK
           kinase (MAP3Ka)[Arabidopsis thaliana]
           gi|4204912|gb|AAD10848
          Length = 608

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++ Y +        + ++Y+    + + L+  G  +  ++ N  RQ+   L  LH 
Sbjct: 273 HPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHG 332

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 333 RNTVHRDIK 341


>At1g53570.1 68414.m06080 mitogen-activated protein kinase kinase
           kinase (MAPKKK), putative (MAP3Ka) identical to MEK
           kinase (MAP3Ka)[Arabidopsis thaliana]
           gi|4204912|gb|AAD10848
          Length = 609

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++ Y +        + ++Y+    + + L+  G  +  ++ N  RQ+   L  LH 
Sbjct: 273 HPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHG 332

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 333 RNTVHRDIK 341


>At5g21222.1 68418.m02532 protein kinase family protein contains
           Pfam profile: PF00069 protein kinase domain
          Length = 831

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+N HPN +++Y          IV+++I    LF+ ++  G ++        +Q
Sbjct: 61  EISIMKLIN-HPNVVQLYEVLASKAKIYIVLEFISGGKLFDKIKNDGRMNEDEAQRYFQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 120 LINAVDYCHSRGVYHRDLK 138


>At1g49180.1 68414.m05514 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 408

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/70 (27%), Positives = 35/70 (50%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN I++       +  V+V++Y D   L   +Q  G +   +    ++Q+   L  +H
Sbjct: 62  DHPNIIRLLHVSQDDDFLVMVLEYCDGGTLSSYIQRYGRVEEDIAKRFMKQIGAGLEIIH 121

Query: 31  KHNFIHNDIK 2
            ++ IH D+K
Sbjct: 122 DNHIIHRDLK 131


>At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum]
          Length = 534

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/79 (25%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + Q +   PN ++    +   +N  +VM+     +LF+ +  KG  S +  +NI RQ
Sbjct: 133 EVMILQHLTGQPNIVEFRGAYEDKDNLHLVMELCSGGELFDRIIKKGSYSEKEAANIFRQ 192

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H    +H D+K
Sbjct: 193 IVNVVHVCHFMGVVHRDLK 211


>At4g14350.2 68417.m02211 protein kinase family protein contains
           similarity to Swiss-Prot:O13310 serine/threonine-protein
           kinase orb6 [Schizosaccharomyces pombe]
          Length = 551

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y +        ++M+Y+   D+   L  K  L+       I +   A+  +HKHN+I
Sbjct: 180 VKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYIGETVLAIESIHKHNYI 239

Query: 16  HNDIK 2
           H DIK
Sbjct: 240 HRDIK 244


>At4g14350.1 68417.m02210 protein kinase family protein contains
           similarity to Swiss-Prot:O13310 serine/threonine-protein
           kinase orb6 [Schizosaccharomyces pombe]
          Length = 551

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y +        ++M+Y+   D+   L  K  L+       I +   A+  +HKHN+I
Sbjct: 180 VKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYIGETVLAIESIHKHNYI 239

Query: 16  HNDIK 2
           H DIK
Sbjct: 240 HRDIK 244


>At5g35410.1 68418.m04208 CBL-interacting protein kinase 24 (CIPK24)
           / serine/threonine protein kinase (SOS2) identical to
           CBL-interacting protein kinase 24 [Arabidopsis thaliana]
           GP|14701910|gb|AAK72257, serine/threonine protein kinase
           SOS2 [Arabidopsis thaliana] GI:7453645
          Length = 446

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 3/96 (3%)
 Frame = -3

Query: 280 VFAENNFGANFNVDEIKVH-QLMN--DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL 110
           + A++    N  VD+IK    +M    HPN +++Y      +   IV++++   +LF+ +
Sbjct: 41  IMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRI 100

Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             KG L         +QL +A+   H     H D+K
Sbjct: 101 VHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLK 136


>At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDPK9)
           identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|836938|gb|AAA67653; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 490

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/79 (21%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   ++++PN ++I   +    N  +VM+  +  +LF+ +  +G  S +  + +I+ 
Sbjct: 70  EIQIMHHLSEYPNVVRIESAYEDTKNVHLVMELCEGGELFDRIVKRGHYSEREAAKLIKT 129

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 130 IVGVVEACHSLGVVHRDLK 148


>At5g12480.1 68418.m01466 calmodulin-domain protein kinase isoform 7
           (CPK7) identical to calmodulin-domain protein kinase
           CDPK isoform 7 [Arabidopsis thaliana]
           gi|1399277|gb|AAB03247
          Length = 535

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/79 (21%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + M  HPN + +  +    +   IVM+  +  +LF+ +  +G  + +  + +++ 
Sbjct: 107 EVEIMKHMPKHPNVVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKT 166

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   HK   +H D+K
Sbjct: 167 IVEVVQICHKQGVMHRDLK 185


>At5g09890.1 68418.m01143 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069
          Length = 515

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/70 (24%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D    +K++++        ++M+Y+   D+   L  +  LS  +    I +   A++ +H
Sbjct: 158 DSRYIVKLFYSFQDSECLYLIMEYLPGGDIMTLLMREDILSEDVARFYIAESILAIHSIH 217

Query: 31  KHNFIHNDIK 2
           +HN++H DIK
Sbjct: 218 QHNYVHRDIK 227


>At3g23310.1 68416.m02940 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069
          Length = 568

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 18/65 (27%), Positives = 32/65 (49%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y +        ++M+Y+   D+   L  K  L+       + +   A+  +HKHN+I
Sbjct: 181 VKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIESIHKHNYI 240

Query: 16  HNDIK 2
           H DIK
Sbjct: 241 HRDIK 245


>At3g23000.1 68416.m02900 CBL-interacting protein kinase 7 (CIPK7)
           identical to CBL-interacting protein kinase 7
           [Arabidopsis thaliana] gi|13249113|gb|AAK16682; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 7 (CIPK7) GI:13249112
          Length = 429

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 21/81 (25%), Positives = 35/81 (43%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           + EI   + +  HPN +KI+      +   +VM+     +LF  +  +G L         
Sbjct: 71  IREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYF 130

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +QL  AL   H+    H D+K
Sbjct: 131 QQLASALRFSHQDGVAHRDVK 151


>At4g33080.1 68417.m05678 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069
          Length = 519

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++        ++M+Y+   D+   L  +  L   +    I Q   A+  +H++N+I
Sbjct: 155 VKLYYSFQDPEYLYLIMEYLPGGDMMTLLMREDTLREDVARFYIAQSVLAIESIHRYNYI 214

Query: 16  HNDIK 2
           H DIK
Sbjct: 215 HRDIK 219


>At4g10730.1 68417.m01753 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 708

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 6/90 (6%)
 Frame = -3

Query: 253 NFNVDEIKVH-QLMN--DHPNFIKIYFNHGFINNQVIVMDYI---DCPDLFETLQIKGEL 92
           N N+D+I+   Q M   DHPN IK + +    ++  +VM ++    C  L +     G  
Sbjct: 84  NSNLDDIRREAQTMTLIDHPNVIKSFCSFAVDHHLWVVMPFMAQGSCLHLMKAAYPDG-F 142

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
               + +++++  +AL+ LH+   IH D+K
Sbjct: 143 EEAAICSMLKETLKALDYLHRQGHIHRDVK 172


>At1g61950.1 68414.m06988 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase GI:3283996 from [Nicotiana tabacum]; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 551

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   ++  PN ++I   +    +  +VM+  +  +LF+ +  +G  S +  + IIR 
Sbjct: 146 EIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGELFDKITKRGHYSEKAAAEIIRS 205

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + +   H    IH D+K
Sbjct: 206 VVKVVQICHFMGVIHRDLK 224


>At1g50700.1 68414.m05701 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 9 [Arabidopsis thaliana]
           gi|1399265|gb|AAB03242
          Length = 521

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNII 65
           EI++ Q ++  PN ++  F   + + + +  VM+     +LF+ +  KG  S +  +++ 
Sbjct: 121 EIQIMQHLSGQPNIVE--FKGAYEDEKAVNLVMELCAGGELFDRILAKGHYSERAAASVC 178

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+   +N  H    +H D+K
Sbjct: 179 RQIVNVVNICHFMGVMHRDLK 199


>At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDPK2)
           identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 495

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKI---YFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           EI++   +++HPN ++I   Y +  F++   IVM+  +  +LF+ +  KG  S +    +
Sbjct: 74  EIQIMHHLSEHPNVVRIKGTYEDSVFVH---IVMEVCEGGELFDRIVSKGHFSEREAVKL 130

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I+ +   +   H    +H D+K
Sbjct: 131 IKTILGVVEACHSLGVMHRDLK 152


>At5g57630.1 68418.m07200 CBL-interacting protein kinase 21,
           putative (CIPK21) identical to CBL-interacting protein
           kinase 21 [Arabidopsis thaliana] gi|14334390|gb|AAK59696
          Length = 416

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 22/79 (27%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+  +L+N HPN ++I+   G      IVM+Y+    L + L  + ++       + +Q
Sbjct: 60  EIRTMKLLN-HPNIVQIHEVIGTKTKICIVMEYVSGGQLSDRLG-RQKMKESDARKLFQQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +A++  H     H D+K
Sbjct: 118 LIDAVDYCHNRGVYHRDLK 136


>At4g09570.1 68417.m01575 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 501

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 21/82 (25%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKI---YFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           EI++   +++HPN ++I   Y +  F++   IVM+  +  +LF+ +  KG  S +  + +
Sbjct: 73  EIQIMHHLSEHPNVVRIKGTYEDSVFVH---IVMEVCEGGELFDRIVSKGCFSEREAAKL 129

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I+ +   +   H    +H D+K
Sbjct: 130 IKTILGVVEACHSLGVMHRDLK 151


>At4g04740.1 68417.m00695 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Lycopersicon esculentum]
           gi|19171502|emb|CAC87494
          Length = 520

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 18/79 (22%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ Q ++  PN ++I  ++   ++  +VM+     +LF+ +  +G  S +  +  I+ 
Sbjct: 117 EIQIMQHLSGQPNVVEIKGSYEDRHSVHLVMELCAGGELFDRIIAQGHYSERAAAGTIKS 176

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + +   H +  IH D+K
Sbjct: 177 IVDVVQICHLNGVIHRDLK 195


>At2g30360.1 68415.m03695 CBL-interacting protein kinase 11 (CIPK11)
           identical to CBL-interacting protein kinase 11
           [Arabidopsis thaliana] gi|13249121|gb|AAK16686; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 11 (CIPK11)partial cds GI:13249120
          Length = 435

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 20/79 (25%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + + ++ HPN +K++      +     M+++   +LF  +   G LS  L     +Q
Sbjct: 70  EISIMRRLS-HPNIVKLHEVMATKSKIFFAMEFVKGGELFNKISKHGRLSEDLSRRYFQQ 128

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+   H     H D+K
Sbjct: 129 LISAVGYCHARGVYHRDLK 147


>At5g19360.1 68418.m02307 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748
          Length = 523

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 16/79 (20%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   +   PN +++   +   ++  +VM+     +LF+ +  KG  S +  ++++R 
Sbjct: 116 EVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRT 175

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + ++  H    IH D+K
Sbjct: 176 IVQIIHTCHSMGVIHRDLK 194


>At4g04720.1 68417.m00693 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase(CDPK) [Carrot] SWISS-PROT:P28582
          Length = 531

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 19/79 (24%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ Q ++  PN ++I   +    +  +VM+     +LF+ +  +G  S +  + IIR 
Sbjct: 128 EIQIMQYLSGQPNIVEIKGAYEDRQSIHLVMELCAGGELFDRIIAQGHYSERAAAGIIRS 187

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 188 IVNVVQICHFMGVVHRDLK 206


>At5g12180.1 68418.m01429 calcium-dependent protein kinase, putative
           / CDPK, putative
          Length = 528

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 16/79 (20%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   +   PN +++   +   ++  +VM+     +LF+ +  KG  S +  ++++R 
Sbjct: 121 EVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRT 180

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + ++  H    IH D+K
Sbjct: 181 IVQIVHTCHSMGVIHRDLK 199


>At2g45490.1 68415.m05658 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069; similar to protein kinase
           p46XlEg22 [Xenopus laevis] gi|609280|emb|CAA78914
          Length = 288

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN +++ F     N ++ ++++Y    +L+  L+  G L+ Q  +  I  L +AL   H
Sbjct: 79  HPNILRL-FGWFHDNERIFLILEYAHGGELYGVLKQNGHLTEQQAATYIASLSQALAYCH 137

Query: 31  KHNFIHNDIK 2
               IH DIK
Sbjct: 138 GKCVIHRDIK 147


>At2g26980.4 68415.m03240 CBL-interacting protein kinase 3 (CIPK3)
           identical to CBL-interacting protein kinase 3
           [Arabidopsis thaliana] gi|9280638|gb|AAF86507
          Length = 382

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN +++Y          I+++Y+   +LF+ +   G +         +Q
Sbjct: 62  EIATMKLIK-HPNVVQLYEVMASKTKIFIILEYVTGGELFDKIVNDGRMKEDEARRYFQQ 120

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 121 LIHAVDYCHSRGVYHRDLK 139


>At2g26980.3 68415.m03237 CBL-interacting protein kinase 3 (CIPK3)
           identical to CBL-interacting protein kinase 3
           [Arabidopsis thaliana] gi|9280638|gb|AAF86507
          Length = 441

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN +++Y          I+++Y+   +LF+ +   G +         +Q
Sbjct: 62  EIATMKLIK-HPNVVQLYEVMASKTKIFIILEYVTGGELFDKIVNDGRMKEDEARRYFQQ 120

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 121 LIHAVDYCHSRGVYHRDLK 139


>At2g26980.2 68415.m03238 CBL-interacting protein kinase 3 (CIPK3)
           identical to CBL-interacting protein kinase 3
           [Arabidopsis thaliana] gi|9280638|gb|AAF86507
          Length = 375

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN +++Y          I+++Y+   +LF+ +   G +         +Q
Sbjct: 62  EIATMKLIK-HPNVVQLYEVMASKTKIFIILEYVTGGELFDKIVNDGRMKEDEARRYFQQ 120

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 121 LIHAVDYCHSRGVYHRDLK 139


>At2g26980.1 68415.m03239 CBL-interacting protein kinase 3 (CIPK3)
           identical to CBL-interacting protein kinase 3
           [Arabidopsis thaliana] gi|9280638|gb|AAF86507
          Length = 382

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN +++Y          I+++Y+   +LF+ +   G +         +Q
Sbjct: 62  EIATMKLIK-HPNVVQLYEVMASKTKIFIILEYVTGGELFDKIVNDGRMKEDEARRYFQQ 120

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 121 LIHAVDYCHSRGVYHRDLK 139


>At1g48260.1 68414.m05390 CBL-interacting protein kinase 17 (CIPK17)
           identical to CBL-interacting protein kinase 17
           [Arabidopsis thaliana] gi|14571553|gb|AAK64513
          Length = 432

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+  +++  HPN ++++          +V++ +   DLF+ +  KG+LS      + +Q
Sbjct: 59  EIRTLKVLK-HPNIVRLHEVLASKTKIYMVLECVTGGDLFDRIVSKGKLSETQGRKMFQQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L + ++  H     H D+K
Sbjct: 118 LIDGVSYCHNKGVFHRDLK 136


>At5g25110.1 68418.m02975 CBL-interacting protein kinase 25 (CIPK25)
           identical to CBL-interacting protein kinase 25
           [Arabidopsis thaliana] gi|17646697|gb|AAL41008
          Length = 488

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+  HPN +++            +M+Y+   +LF  + +KG+L         +Q
Sbjct: 91  EISIMRLVR-HPNIVELKEVMATKTKIFFIMEYVKGGELFSKI-VKGKLKEDSARKYFQQ 148

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 149 LISAVDFCHSRGVSHRDLK 167


>At4g24400.1 68417.m03499 CBL-interacting protein kinase 8 (CIPK8)
           identical to CBL-interacting protein kinase 8
           [Arabidopsis thaliana] GP|13249115|gb|AAK16683; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain
          Length = 445

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 20/79 (25%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+  HP  +++Y          I+++YI   +LF+ +   G LS         Q
Sbjct: 57  EISIMKLVR-HPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSESEARKYFHQ 115

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L + ++  H     H D+K
Sbjct: 116 LIDGVDYCHSKGVYHRDLK 134


>At1g23700.1 68414.m02992 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 473

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 20/80 (25%), Positives = 44/80 (55%), Gaps = 3/80 (3%)
 Frame = -3

Query: 232 KVHQL-MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ--IKGELSHQLVSNIIR 62
           +VH+L + DHPN ++++ +    ++  IVM ++ C      ++      L   +++ ++R
Sbjct: 58  EVHRLSLIDHPNLLRVHCSFIDSSSLWIVMPFMSCGSSLNIMKSVYPNGLEEPVIAILLR 117

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           ++ +AL  LH    IH ++K
Sbjct: 118 EILKALVYLHGLGHIHRNVK 137


>At1g08650.1 68414.m00960 phosphoenolpyruvate carboxylase kinase
           identical to phosphoenolpyruvate carboxylase kinase
           [Arabidopsis thaliana] gi|6318613|gb|AAF06968; contains
           protein kinase domain, Pfam:PF00069
          Length = 284

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYID-CPDLFETLQIKGELSHQLVSNII 65
           +E K+  L++ HPN ++I+      +   I M+ +     +++ L   G       ++  
Sbjct: 62  NEPKLMALLSYHPNIVQIHDLIDTDSTLSIFMELVHPSVSIYDRLVSSGTFFEPQTASFA 121

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+ +AL+  H++  +H DIK
Sbjct: 122 KQILQALSHCHRYGVVHRDIK 142


>At5g60550.1 68418.m07592 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 407

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           E+ + +++ +HPN + +    +    ++  +V++Y+D   +++     G L  +     +
Sbjct: 161 EVMIMKIL-EHPNIVNLIEVIDDPETDHFYMVLEYVDGKWVYDGSGPPGALGEKTARKYL 219

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R +   L  LH H+ IH DIK
Sbjct: 220 RDIVTGLMYLHAHDVIHGDIK 240


>At5g21326.1 68418.m02534 protein kinase family protein / NAF
           domain-containing protein contains Pfam profiles:
           PF00069 protein kinase domain, PF03822 NAF domain
          Length = 439

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 21/79 (26%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+N HPN +++Y          IV+++    +LF+ +   G L  +      +Q
Sbjct: 61  EICTMKLIN-HPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 120 LINAVDYCHSRGVYHRDLK 138


>At2g17890.1 68415.m02072 calcium-dependent protein kinase family
           protein / CDPK family protein contains Pfam domains,
           PF00069: Protein kinase domain and PF00036: EF hand
          Length = 571

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 18/81 (22%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK--GELSHQLVSNII 65
           E+K+ Q +  H N ++ Y      N+  IVM+  +  +L + +  +     S +  + ++
Sbjct: 156 EVKILQALTGHENVVRFYNAFEDKNSVYIVMELCEGGELLDRILARKDSRYSERDAAVVV 215

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ +   + H    +H D+K
Sbjct: 216 RQMLKVAAECHLRGLVHRDMK 236


>At3g51850.1 68416.m05686 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 528

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 13/51 (25%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+  +  +LF+ +  +G  + +  + + + + E +   HKH  IH D+K
Sbjct: 130 LVMELCEGGELFDRIVARGHYTERAAAGVTKTIVEVVQLCHKHGVIHRDLK 180


>At3g06230.1 68416.m00716 mitogen-activated protein kinase kinase
           (MAPKK), putative (MKK8) mitogen-activated protein
           kinase kinase (MAPKK) family, PMID:12119167
          Length = 293

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+MDY+D   L E+L+   E    L+S   RQ+ E  N LH+H  +H DIK
Sbjct: 123 ILMDYMDLGSL-ESLRGVTEKQLALMS---RQVLEGKNYLHEHKIVHRDIK 169


>At1g30270.1 68414.m03702 CBL-interacting protein kinase 23 (CIPK23)
           identical to CBL-interacting protein kinase 23
           [Arabidopsis thaliana] gi|14486386|gb|AAK61494
          Length = 482

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 19/79 (24%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN I+++           V++++   +LF+ +   G L         +Q
Sbjct: 79  EISTMKLIK-HPNVIRMFEVMASKTKIYFVLEFVTGGELFDKISSNGRLKEDEARKYFQQ 137

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 138 LINAVDYCHSRGVYHRDLK 156


>At1g03920.1 68414.m00377 protein kinase, putative contains protein
           kinase domain, Pfam:PF00069
          Length = 569

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 18/65 (27%), Positives = 30/65 (46%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y +        ++M+Y+   D+   L  K  LS       I +   A+  +H  N+I
Sbjct: 198 VKLYCSFQDNEYLYLIMEYLPGGDMMTLLMRKDTLSEDEAKFYIAESVLAIESIHNRNYI 257

Query: 16  HNDIK 2
           H DIK
Sbjct: 258 HRDIK 262


>At5g14720.1 68418.m01727 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 674

 Score = 35.5 bits (78), Expect = 0.042
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYI---DCPDLFETLQIKGELSHQLVSNI 68
           E++   L+N HPN ++ + +    +   +VM Y+    C  + ++    G     +++ +
Sbjct: 62  EVQTMSLIN-HPNVLQAHCSFTTGHQLWVVMPYMAGGSCLHIIKSSYPDG-FEEPVIATL 119

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +R+  +AL  LH H  IH D+K
Sbjct: 120 LRETLKALVYLHAHGHIHRDVK 141


>At3g45240.1 68416.m04882 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 396

 Score = 35.5 bits (78), Expect = 0.042
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           +HPN + +    +    ++  +V++Y+D    ++     G L        +R +   L  
Sbjct: 170 EHPNIVNLIEVIDDPEFDDFYMVLEYVDGKWAYDDSGPPGALGEITARKYLRDVVAGLMY 229

Query: 37  LHKHNFIHNDIK 2
           LH HN IH DIK
Sbjct: 230 LHAHNVIHGDIK 241


>At5g58380.1 68418.m07311 CBL-interacting protein kinase 10 (CIPK10)
           identical to CBL-interacting protein kinase 10
           [Arabidopsis thaliana] gi|13249119|gb|AAK16685; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 10 (CIPK10) GI:13249118
          Length = 479

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 23/79 (29%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI V ++   HPN +++Y           VM+Y    +LF  +  KG+L   +      Q
Sbjct: 60  EISVMRIAR-HPNVVELYEVMATKTRIYFVMEYCKGGELFNKVA-KGKLRDDVAWKYFYQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H DIK
Sbjct: 118 LINAVDFCHSREVYHRDIK 136


>At5g18700.1 68418.m02219 protein kinase-related contains protein
           kinase domain, INTERPRO:IPR000719
          Length = 1366

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 22/81 (27%), Positives = 39/81 (48%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           + E+++   +N HPN +K Y  +    +  +V++Y    DL   LQ   +L  + +  + 
Sbjct: 44  LQEVRILHSLN-HPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLA 102

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
             L  AL  LH    I+ D+K
Sbjct: 103 YDLVIALQYLHSKGIIYCDLK 123


>At4g23650.1 68417.m03405 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 529

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 15/79 (18%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   ++ H N + +   +   ++  ++M+  +  +LF+ +  KG  S +  +++ RQ
Sbjct: 126 EVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIISKGLYSERAAADLCRQ 185

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H    +H D+K
Sbjct: 186 MVMVVHSCHSMGVMHRDLK 204


>At3g08730.1 68416.m01015 serine/threonine protein kinase (PK1)
           (PK6) identical to serine/threonine-protein kinase
           AtPK1/AtPK6 (ribosomal-protein S6 kinase ATPK6)
           [Arabidopsis thaliana] SWISS-PROT:P42818
          Length = 465

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHP  +++ ++        +V+D+I+   LF  L  +G     L      ++  A++ LH
Sbjct: 190 DHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLH 249

Query: 31  KHNFIHNDIK 2
           +   +H D+K
Sbjct: 250 EKGIMHRDLK 259


>At3g08720.2 68416.m01014 serine/threonine protein kinase (PK19)
           identical to serine/threonine-protein kinase AtPK19
           (Ribosomal-protein S6 kinase homolog) [Arabidopsis
           thaliana] SWISS-PROT:Q39030
          Length = 471

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHP  +++ ++        +V+D+I+   LF  L  +G     L      ++  A++ LH
Sbjct: 196 DHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLH 255

Query: 31  KHNFIHNDIK 2
           +   +H D+K
Sbjct: 256 EKGIMHRDLK 265


>At3g08720.1 68416.m01013 serine/threonine protein kinase (PK19)
           identical to serine/threonine-protein kinase AtPK19
           (Ribosomal-protein S6 kinase homolog) [Arabidopsis
           thaliana] SWISS-PROT:Q39030
          Length = 471

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHP  +++ ++        +V+D+I+   LF  L  +G     L      ++  A++ LH
Sbjct: 196 DHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLH 255

Query: 31  KHNFIHNDIK 2
           +   +H D+K
Sbjct: 256 EKGIMHRDLK 265


>At1g01140.3 68414.m00020 CBL-interacting protein kinase 9 (CIPK9)
           identical to CBL-interacting protein kinase 9
           [Arabidopsis thaliana] gi|13249117|gb|AAK16684; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 9 (CIPK9) GI:13249116
          Length = 451

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 20/79 (25%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN ++I           IV++ ++  +LF+ +  +G L         +Q
Sbjct: 67  EISTMKLIK-HPNVVEIIEVMASKTKIYIVLELVNGGELFDKIAQQGRLKEDEARRYFQQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 126 LINAVDYCHSRGVYHRDLK 144


>At1g01140.2 68414.m00019 CBL-interacting protein kinase 9 (CIPK9)
           identical to CBL-interacting protein kinase 9
           [Arabidopsis thaliana] gi|13249117|gb|AAK16684; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 9 (CIPK9) GI:13249116
          Length = 449

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 20/79 (25%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN ++I           IV++ ++  +LF+ +  +G L         +Q
Sbjct: 67  EISTMKLIK-HPNVVEIIEVMASKTKIYIVLELVNGGELFDKIAQQGRLKEDEARRYFQQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 126 LINAVDYCHSRGVYHRDLK 144


>At1g01140.1 68414.m00018 CBL-interacting protein kinase 9 (CIPK9)
           identical to CBL-interacting protein kinase 9
           [Arabidopsis thaliana] gi|13249117|gb|AAK16684; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 9 (CIPK9) GI:13249116
          Length = 447

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 20/79 (25%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN ++I           IV++ ++  +LF+ +  +G L         +Q
Sbjct: 67  EISTMKLIK-HPNVVEIIEVMASKTKIYIVLELVNGGELFDKIAQQGRLKEDEARRYFQQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 126 LINAVDYCHSRGVYHRDLK 144


>At5g23170.1 68418.m02710 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 341

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 2/82 (2%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI-- 68
           +EI V   +  HP+ +      G    +++V++Y+    L++ L +  +     +  I  
Sbjct: 77  NEIDVMSSLPYHPHVLSFL---GHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEI 133

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
             Q+  A++ LH+H  IH DIK
Sbjct: 134 ALQIASAVHFLHEHGIIHRDIK 155


>At5g07070.1 68418.m00800 CBL-interacting protein kinase 2 (CIPK2)
           identical to CBL-interacting protein kinase 2
           [Arabidopsis thaliana] gi|9280636|gb|AAF86506
          Length = 456

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 22/79 (27%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI V ++   HPN +++Y      +    V++Y    +LF  +  KG+L   +      Q
Sbjct: 60  EISVMRIAK-HPNVVELYEVMATKSRIYFVIEYCKGGELFNKVA-KGKLKEDVAWKYFYQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H DIK
Sbjct: 118 LISAVDFCHSRGVYHRDIK 136


>At4g21940.1 68417.m03174 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423
          Length = 554

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 18/79 (22%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ Q ++   N ++I   +    +  +VM+     +LF+ +  +G  S +  + +IR 
Sbjct: 150 EIQIMQYLSGQENIVEIKGAYEDRQSIHLVMELCGGSELFDRIIAQGHYSEKAAAGVIRS 209

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    IH D+K
Sbjct: 210 VLNVVQICHFMGVIHRDLK 228


>At3g20410.1 68416.m02585 calmodulin-domain protein kinase isoform 9
           (CPK9) identical to calmodulin-domain protein kinase
           CDPK isoform 9 [Arabidopsis thaliana]
           gi|1399265|gb|AAB03242
          Length = 541

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 18/81 (22%), Positives = 41/81 (50%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNII 65
           EI++ Q ++  PN ++  F   + + + +  VM+     +LF+ +  KG  + +  +++ 
Sbjct: 139 EIQIMQHLSGQPNIVE--FKGAYEDEKAVNLVMELCAGGELFDRIIAKGHYTERAAASVC 196

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+   +   H    +H D+K
Sbjct: 197 RQIVNVVKICHFMGVLHRDLK 217


>At2g23030.1 68415.m02746 protein kinase, putative similar to
           protein kinase 3 [Glycine max] GP|310582|gb|AAB68961
          Length = 339

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 1/95 (1%)
 Frame = -3

Query: 283 IVFAENNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ 107
           + F +  +  + NV  EI  H+ +N HPN ++         +  IVM+Y    +LFE + 
Sbjct: 32  VKFIDRGYKIDENVAREIINHRALN-HPNIVRFKEVVLTPTHLGIVMEYAAGGELFERIS 90

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             G  S        +QL   ++ LH     H D+K
Sbjct: 91  SVGRFSEAEARYFFQQLICGVHYLHALQICHRDLK 125


>At1g50230.1 68414.m05632 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 269

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I++  +        +V ++    +LFE L+    L  + V  I +QL +AL+ LH 
Sbjct: 62  HENIIEMLDSFENAREFCVVTEFAQ-GELFEILEDDKCLPEEQVQAIAKQLVKALDYLHS 120

Query: 28  HNFIHNDIK 2
           +  IH D+K
Sbjct: 121 NRIIHRDMK 129


>At1g48490.1 68414.m05420 protein kinase, putative similar to
           incomplete root hair elongation (IRE) [Arabidopsis
           thaliana] gi|6729346|dbj|BAA89783
          Length = 878

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 17/69 (24%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           +P  ++ +++     N  +VM+Y++  D +  L+  G L        I ++  AL  LH 
Sbjct: 528 NPFVVRFFYSFTCSENLYLVMEYLNGGDFYSMLRKIGCLDEANARVYIAEVVLALEYLHS 587

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 588 EGVVHRDLK 596


>At1g09000.1 68414.m01004 NPK1-related protein kinase, putative
           (ANP1) similar to protein kinase [Nicotiana tabacum]
           gi|456309|dbj|BAA05648; identical to cDNA NPK1-related
           protein kinase 1S GI:2342422
          Length = 666

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +E+K+ + ++ HPN ++        +   I+++++    +   L+  G     +V    R
Sbjct: 121 EEVKLLKNLS-HPNIVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTR 179

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL   L  LH H  +H DIK
Sbjct: 180 QLLLGLEYLHNHAIMHRDIK 199


>At5g56580.1 68418.m07061 mitogen-activated protein kinase kinase
           (MAPKK), putative (MKK6) similar to NQK1 MAPKK
           [Nicotiana tabacum] gi|12718822|dbj|BAB32405;
           mitogen-activated protein kinase kinase (MAPKK) family,
           PMID:12119167
          Length = 356

 Score = 34.3 bits (75), Expect = 0.097
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV--IVMDYIDCPDLFETLQIKGELSHQLVSN 71
           V E+K++Q  +  P+ +  Y  H F +N    +V++Y+D   L + ++    +    ++ 
Sbjct: 114 VQELKINQASSQCPHVVVCY--HSFYHNGAFSLVLEYMDRGSLADVIRQVKTILEPYLAV 171

Query: 70  IIRQLCEALNDLH-KHNFIHNDIK 2
           + +Q+   L  LH + + IH DIK
Sbjct: 172 VCKQVLLGLVYLHNERHVIHRDIK 195


>At5g45820.1 68418.m05635 CBL-interacting protein kinase 20 (CIPK20)
           identical to CBL-interacting protein kinase 20
           [Arabidopsis thaliana] gi|14486384|gb|AAK61493
          Length = 439

 Score = 34.3 bits (75), Expect = 0.097
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI V +L+  HP+ + ++            M+Y+   +LF+ +  KG+L   +     +Q
Sbjct: 60  EISVMRLVR-HPHVVFLHEVMASKTKIYFAMEYVKGGELFDKVS-KGKLKENIARKYFQQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 118 LIGAIDYCHSRGVYHRDLK 136


>At3g21220.1 68416.m02682 mitogen-activated protein kinase kinase
           (MAPKK), putative (MKK5) identical to GB:BAA28831 from
           [Arabidopsis thaliana]; mitogen-activated protein kinase
           kinase (MAPKK) family, PMID:12119167
          Length = 348

 Score = 34.3 bits (75), Expect = 0.097
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKIY--FNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           DHPN +K +  F+H   N ++ ++++++D   L E   I  E   Q ++++ RQ+   L 
Sbjct: 124 DHPNVVKCHDMFDH---NGEIQVLLEFMDQGSL-EGAHIWQE---QELADLSRQILSGLA 176

Query: 40  DLHKHNFIHNDIK 2
            LH+ + +H DIK
Sbjct: 177 YLHRRHIVHRDIK 189


>At2g42630.1 68415.m05276 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 357

 Score = 34.3 bits (75), Expect = 0.097
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIRQLCEALNDLH 32
           HPN I +           +V +Y+    L++ ++  K ELS Q    I+ ++C  L  +H
Sbjct: 158 HPNVILLLGACTKPPQLSLVTEYMSTGSLYDVIRTRKKELSWQRKLKILAEICRGLMYIH 217

Query: 31  KHNFIHNDI 5
           K   +H D+
Sbjct: 218 KMGIVHRDL 226


>At4g32830.1 68417.m04669 protein kinase, putative similar to
           protein kinase p46XlEg22 [Xenopus laevis]
           gi|609280|emb|CAA78914; contains protein kinase domain,
           Pfam:PF00069
          Length = 294

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y    +L++ LQ     S +  +  +  L  AL   H 
Sbjct: 88  HPNILRLYGYFYDQKRVYLILEYAARGELYKDLQKCKYFSERRAATYVASLARALIYCHG 147

Query: 28  HNFIHNDIK 2
            + IH DIK
Sbjct: 148 KHVIHRDIK 156


>At4g08470.1 68417.m01398 mitogen-activated protein kinase, putative
           similar to mitogen-activated protein kinase [Arabidopsis
           thaliana] gi|1255448|dbj|BAA09057; contains Pfam
           PF00069: Protein kinase domain
          Length = 560

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +LS+ +VS   RQ+   LN LH   F+H DIK
Sbjct: 397 QLSYTVVSLYTRQILAGLNYLHDKGFVHRDIK 428


>At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to
           MAP3K epsilon protein kinase [Arabidopsis thaliana]
           gi|3549652|emb|CAA12272
          Length = 1368

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 3/96 (3%)
 Frame = -3

Query: 280 VFAENNFGANFNVDEIKVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI 104
           V  EN    + N    ++  L N +H N +K   +     +  I+++Y++   L   ++ 
Sbjct: 51  VSLENIVQEDLNTIMQEIDLLKNLNHKNIVKYLGSSKTKTHLHIILEYVENGSLANIIKP 110

Query: 103 K--GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              G     LV+  I Q+ E L  LH+   IH DIK
Sbjct: 111 NKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIK 146


>At2g37840.1 68415.m04645 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 733

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 22/81 (27%), Positives = 38/81 (46%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           + EI + + +N HPN I++           +V++Y    DL   +Q  G +      + +
Sbjct: 57  MSEIFILRRIN-HPNIIRLIDMIKSPGKVHLVLEYCKGGDLSVYVQRHGIVPEATAKHFM 115

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +QL   L  L  +N IH D+K
Sbjct: 116 QQLAAGLQVLRDNNIIHRDLK 136


>At4g18950.1 68417.m02792 ankyrin protein kinase, putative similar
           to ankyrin-kinase [Medicago truncatula]
           gi|18700701|gb|AAL78674
          Length = 459

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 3/112 (2%)
 Frame = -3

Query: 328 AFWQNIYFIAQAH*QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIV 149
           A W+ I    +     V ++++    F+ DE+ + Q +  HPN ++        N  +IV
Sbjct: 174 AMWRGIQVAVKKLDDEVLSDDDQVRKFH-DELALLQRLR-HPNIVQFLGAVTQSNPMMIV 231

Query: 148 MDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK---HNFIHNDIK 2
            +Y+   DL E L+ KG+L           +   ++ LH+      IH D++
Sbjct: 232 TEYLPRGDLRELLKRKGQLKPATAVRYALDIARGMSYLHEIKGDPIIHRDLE 283


>At2g46700.1 68415.m05827 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase homolog MCK1 [Zea mays]
           gi|1839597|gb|AAB47181
          Length = 595

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIR 62
           E+K+ + ++ H   IK Y      NN  IVM+  D  +L + +  + G+        I+ 
Sbjct: 194 EVKLLKSLSGHKYLIKYYDACEDANNVYIVMELCDGGELLDRILARGGKYPEDDAKAIVV 253

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   ++  H    +H D+K
Sbjct: 254 QILTVVSFCHLQGVVHRDLK 273


>At2g41920.1 68415.m05186 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 318

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = -3

Query: 223 QLMNDHPNFIKIYFNH-GFINNQVIVMDYIDCPDLFETL-QIKG-ELSHQLVSNIIRQLC 53
           +++  + N +K  FN  G++  + I M+Y     L + + + K  +LS  ++    R L 
Sbjct: 64  RIVQCYGNGVKEIFNDKGYVEYK-IAMEYAFGGSLSDFMDRFKDRKLSDSMIREFTRMLL 122

Query: 52  EALNDLHKHNFIHNDIK 2
           E L  +H+H ++H D+K
Sbjct: 123 EGLATIHRHGYVHCDLK 139


>At2g25880.1 68415.m03106 serine/threonine protein kinase, putative
           similar to serine/threonine kinase Ayk1 [Mus musculus]
           gi|1763647|gb|AAB62982
          Length = 282

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y    +L++ LQ     S +  +  +  L  AL   H 
Sbjct: 76  HPNILRLYGYFYDQKRVYLILEYAVRGELYKELQKCKYFSERRAATYVASLARALIYCHG 135

Query: 28  HNFIHNDIK 2
            + IH DIK
Sbjct: 136 KHVIHRDIK 144


>At5g24430.1 68418.m02879 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase CaMK1 [Nicotiana tabacum]
           gi|16904222|gb|AAL30818
          Length = 594

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 17/80 (21%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL-VSNIIR 62
           E+K+ + ++ H + +K Y  +   +N  +VM+  +  +L + +  +G    ++    I+ 
Sbjct: 194 EVKLLKALSGHRHMVKFYDVYEDADNVFVVMELCEGGELLDRILARGGRYPEVDAKRILV 253

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A    H    +H D+K
Sbjct: 254 QILSATAFFHLQGVVHRDLK 273


>At3g15220.1 68416.m01923 protein kinase, putative similar to
           serine/threonine protein kinase 24 [Homo sapiens]
           SWISS-PROT:Q9Y6E
          Length = 690

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+M+Y+    + + LQ    L    ++ I R L  A+  LH    IH DIK
Sbjct: 88  IIMEYMAGGSVADLLQSNNPLDETSIACITRDLLHAVEYLHNEGKIHRDIK 138


>At3g10660.1 68416.m01282 calcium-dependent protein kinase isoform 2
           (CPK2) identical to calcium-dependent protein kinase
           isoform 2 [Arabidopsis thaliana] gi|9837343|gb|AAG00535;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 646

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 18/79 (22%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  HPN I I   +  +    +VM+     +LF+ +  +G  + +  + + R 
Sbjct: 234 EIQIMHHLAGHPNVISIKGAYEDVVAVHLVMELCSGGELFDRIIQRGHYTERKAAELART 293

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L   H    +H D+K
Sbjct: 294 IVGVLEACHSLGVMHRDLK 312


>At2g40860.1 68415.m05044 protein kinase family protein / protein
           phosphatase 2C ( PP2C) family protein contains Pfam
           PF00481: Protein phosphatase 2C domain; contains Pfam
           PF00069: Protein kinase domain; similar to partner of
           PIX 1 (GI:21702695) [Homo sapiens]
          Length = 658

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDL 35
           +HP   K+   H    N +   D+ +   L E L ++    S   V  I   L +AL  L
Sbjct: 81  NHPGVAKLLAAHAKPPNYMFFFDFYESGTLAEKLHVEEWSPSIDQVLLITLHLAKALQYL 140

Query: 34  HKHNFIHNDIK 2
           H +  +H D+K
Sbjct: 141 HNNGIVHRDVK 151


>At5g66850.1 68418.m08428 protein kinase family protein contains
           Pfam domain, PF00069: Protein kinase domain; identical
           to cDNA MAP3K gamma protein kinase GI:2315152
          Length = 716

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNII 65
           E ++  L N  HPN ++ + +    +   I ++Y+    + + ++   G ++  +V N  
Sbjct: 394 EQEIKLLSNLQHPNIVQYFGSETVEDRFFIYLEYVHPGSINKYIRDHCGTMTESVVRNFT 453

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R +   L  LH    +H DIK
Sbjct: 454 RHILSGLAYLHNKKTVHRDIK 474


>At5g10930.1 68418.m01268 CBL-interacting protein kinase 5 (CIPK5)
           identical to CBL-interacting protein kinase 5
           GP|9280632|gb|AAF86504 [Arabidopsis thaliana]
          Length = 445

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 20/79 (25%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+  HPN +++            VM+++   +LF  +  KG+L         +Q
Sbjct: 61  EISIMKLVR-HPNIVELKEVMATKTKIFFVMEFVKGGELFCKIS-KGKLHEDAARRYFQQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 119 LISAVDYCHSRGVSHRDLK 137


>At3g58640.2 68416.m06536 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 809

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGE---LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +Y++   L+  L + G+   LS +    ++R +C  L  +H+   +H DIK
Sbjct: 625 LITEYMEMGSLYYLLHLSGQKKRLSWRRKLKMLRDICRGLMCIHRMGIVHRDIK 678


>At3g58640.1 68416.m06535 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 809

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGE---LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +Y++   L+  L + G+   LS +    ++R +C  L  +H+   +H DIK
Sbjct: 625 LITEYMEMGSLYYLLHLSGQKKRLSWRRKLKMLRDICRGLMCIHRMGIVHRDIK 678


>At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K
           epsilon protein kinase [Arabidopsis thaliana]
           gi|3549652|emb|CAA12272
          Length = 1367

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 2/86 (2%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK--GELSHQL 80
           N  + EI + + +N H N +K   +     +  I+++Y++   L   ++    G     L
Sbjct: 62  NTIMQEIDLLKNLN-HKNIVKYLGSLKTKTHLHIILEYVENGSLANIIKPNKFGPFPESL 120

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V+  I Q+ E L  LH+   IH DIK
Sbjct: 121 VTVYIAQVLEGLVYLHEQGVIHRDIK 146


>At1g18350.1 68414.m02293 mitogen-activated protein kinase kinase
           (MAPKK), putative (MKK7) mitogen-activated protein
           kinase kinase (MAPKK) family, PMID:12119167
          Length = 307

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = -3

Query: 184 FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           F    +    I+M+Y+D  +L E+L  +G ++ + ++   RQ+ + L+ LH    +H DI
Sbjct: 110 FEKPIVGEVSILMEYMDGGNL-ESL--RGAVTEKQLAGFSRQILKGLSYLHSLKIVHRDI 166

Query: 4   K 2
           K
Sbjct: 167 K 167


>At4g40010.1 68417.m05665 serine/threonine protein kinase, putative
           similar to serine-threonine protein kinase [Triticum
           aestivum] gi|2055374|gb|AAB58348
          Length = 350

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFIN--NQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           HPN I+  F   F+   +  IVM+Y    +LFE +   G  S        +QL   ++  
Sbjct: 57  HPNIIR--FKEVFVTPTHLAIVMEYAAGGELFERICNAGRFSEDEGRYYFKQLISGVSYC 114

Query: 34  HKHNFIHNDIK 2
           H     H D+K
Sbjct: 115 HAMQICHRDLK 125


>At4g08500.1 68417.m01401 mitogen-activated protein kinase kinase,
           putative similar to mitogen-activated protein kinase
           MEKK1 GP|1255448 [Arabidopsis thaliana]
          Length = 608

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 23/79 (29%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+   +  H N ++        +N  I ++ +    L +  Q + +L   +VS   RQ
Sbjct: 382 EIKLLSQLQ-HQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQ-RYQLRDSVVSLYTRQ 439

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + L  LH   FIH DIK
Sbjct: 440 ILDGLKYLHDKGFIHRDIK 458


>At3g56760.1 68416.m06313 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase CaMK3 [Nicotiana tabacum]
           gi|16904226|gb|AAL30820
          Length = 577

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E+K+ + +  H N ++ Y       N  IVM+     +L +  LQ  G+ S      ++ 
Sbjct: 175 EVKILRALTGHKNLVQFYDAFEDDENVYIVMELCQGGELLDKILQRGGKYSEVDAKKVMI 234

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   +   H    +H D+K
Sbjct: 235 QILSVVAYCHLQGVVHRDLK 254


>At3g49370.1 68416.m05397 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase CaMK1 [Nicotiana tabacum]
           gi|16904222|gb|AAL30818
          Length = 594

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 17/80 (21%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIR 62
           E+K+ + ++ H + +K Y      +N  +VM+  +  +L +++  + G         I+ 
Sbjct: 193 EVKLLKALSGHSHMVKFYDVFEDSDNVFVVMELCEGGELLDSILARGGRYPEAEAKRILV 252

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A    H    +H D+K
Sbjct: 253 QILSATAFFHLQGVVHRDLK 272


>At1g54960.1 68414.m06277 NPK1-related protein kinase, putative
           (ANP2) similar to protein kinase [Nicotiana tabacum]
           gi|456309|dbj|BAA05648; identical to cDNA NPK1-related
           protein kinase 2, partial cds GI:2342424
          Length = 596

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 19/80 (23%), Positives = 36/80 (45%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +E+K+ + ++ HPN ++            I+++++    +   L+  G     +V     
Sbjct: 120 EEVKLLKNLS-HPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTN 178

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL   L  LH H  +H DIK
Sbjct: 179 QLLLGLEYLHNHAIMHRDIK 198


>At1g49580.1 68414.m05559 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase CaMK3 [Nicotiana tabacum]
           gi|16904226|gb|AAL30820; contains protein kinase domain,
           Pfam:PF00069; contains serine/threonine protein kinase
           domain, INTERPRO:IPR002290
          Length = 606

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 18/80 (22%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIR 62
           E+K+ Q ++ H N ++ Y       N  I M+  +  +L + +  + G+ S      +I 
Sbjct: 201 EVKILQALSGHKNLVQFYDAFEDNANVYIAMELCEGGELLDRILARGGKYSENDAKPVII 260

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   +   H    +H D+K
Sbjct: 261 QILNVVAFCHFQGVVHRDLK 280


>At1g03740.1 68414.m00354 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 542

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKI--YFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALN 41
           DHPN +K+         ++  +V +Y+D  DL     + G + +   V   +RQL   L 
Sbjct: 268 DHPNVLKLEGLITAPVSSSLYLVFEYMD-HDLLGLSSLPGVKFTEPQVKCYMRQLLSGLE 326

Query: 40  DLHKHNFIHNDIK 2
             H    +H DIK
Sbjct: 327 HCHSRGVLHRDIK 339


>At5g66210.2 68418.m08341 calcium-dependent protein kinase family
           protein / CDPK family protein contains Pfam domains,
           PF00069: Protein kinase domain and PF00036: EF hand
          Length = 523

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 18/83 (21%), Positives = 43/83 (51%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV--IVMDYIDCPDLFETLQIK--GELSHQLVSN 71
           E+++   ++ H N ++  F++ F ++    IVM+  +  +L + +  K     S +  + 
Sbjct: 110 EVQILIALSGHENVVQ--FHNAFEDDDYVYIVMELCEGGELLDRILSKKGNRYSEKDAAV 167

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           ++RQ+ +   + H H  +H D+K
Sbjct: 168 VVRQMLKVAGECHLHGLVHRDMK 190


>At5g66210.1 68418.m08340 calcium-dependent protein kinase family
           protein / CDPK family protein contains Pfam domains,
           PF00069: Protein kinase domain and PF00036: EF hand
          Length = 523

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 18/83 (21%), Positives = 43/83 (51%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV--IVMDYIDCPDLFETLQIK--GELSHQLVSN 71
           E+++   ++ H N ++  F++ F ++    IVM+  +  +L + +  K     S +  + 
Sbjct: 110 EVQILIALSGHENVVQ--FHNAFEDDDYVYIVMELCEGGELLDRILSKKGNRYSEKDAAV 167

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           ++RQ+ +   + H H  +H D+K
Sbjct: 168 VVRQMLKVAGECHLHGLVHRDMK 190


>At5g63610.1 68418.m07986 protein kinase, putative similar to
           cyclin-dependent kinase cdc2MsE [Medicago sativa]
           gi|1806144|emb|CAA65981; contains protein kinase domain,
           Pfam:PF00069
          Length = 470

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 9/101 (8%)
 Frame = -3

Query: 277 FAENNFGANFNVDEIKVHQLMND--HPNFIKIYFNH-GFINNQV-IVMDYIDCPDLFETL 110
           F ++  G   +   I+   L+ +  H N +K+   H  F +  + +  DY +  DL+E +
Sbjct: 57  FKQSKDGDGVSPTAIREIMLLREISHENVVKLVNVHINFADMSLYLAFDYAEY-DLYEII 115

Query: 109 QI-KGELSHQL----VSNIIRQLCEALNDLHKHNFIHNDIK 2
           +  + ++ H L    V +++ QL   LN LH +  IH D+K
Sbjct: 116 RHHRDKVGHSLNTYTVKSLLWQLLNGLNYLHSNWIIHRDLK 156


>At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative
           similar to mitogen-activated protein kinase [Arabidopsis
           thaliana] gi|1255448|dbj|BAA09057; contains Pfam
           PF00069: Protein kinase domain
          Length = 773

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +H N ++        +N  I ++ +    L E L  + ++   L+S   +Q+ + L  LH
Sbjct: 558 EHQNILRYRGTDKDGSNLYIFLELVTQGSLLE-LYRRYQIRDSLISLYTKQILDGLKYLH 616

Query: 31  KHNFIHNDIK 2
              FIH DIK
Sbjct: 617 HKGFIHRDIK 626


>At3g45790.1 68416.m04955 protein kinase-related contains eukaryotic
           protein kinase domain, INTERPRO:IPR000719
          Length = 376

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  ++++Y     LF+ +    G LS + V  + R +   L+ +H+ N IH DIK
Sbjct: 173 NYNLILEYCSGKSLFDLVNSNLGGLSEKDVKLLARDILYGLDYIHRANIIHCDIK 227


>At3g06030.1 68416.m00688 NPK1-related protein kinase, putative
           (ANP3) similar to protein kinase [Nicotiana tabacum]
           gi|456309|dbj|BAA05648; identical to cDNA NPK1-related
           protein kinase 3 GI:2342426
          Length = 651

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           E +V  L N  HPN ++        ++  I+M+++    +   L+  G     ++    +
Sbjct: 119 EEEVQLLKNLSHPNIVRYLGTVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTK 178

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL   L  LH +  +H DIK
Sbjct: 179 QLLLGLEYLHNNGIMHRDIK 198


>At2g41140.1 68415.m05081 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase CaMK3 [Nicotiana tabacum]
           gi|16904226|gb|AAL30820
          Length = 576

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E+K+ + +  H N ++ Y       N  IVM+     +L +  LQ  G+ S      ++ 
Sbjct: 174 EVKMLRALTGHKNLVQFYDAFEDDENVYIVMELCKGGELLDKILQRGGKYSEDDAKKVMV 233

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   +   H    +H D+K
Sbjct: 234 QILSVVAYCHLQGVVHRDLK 253


>At1g78290.2 68414.m09124 serine/threonine protein kinase, putative
           similar to serine-threonine protein kinase [Triticum
           aestivum] gi|2055374|gb|AAB58348
          Length = 343

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    ++MN     HPN I+         +  +VM+Y    +LF  +   G  S    
Sbjct: 41  IDEHVQREIMNHRSLIHPNIIRFKEVLLTATHLALVMEYAAGGELFGRICSAGRFSEDEA 100

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   +N  H     H D+K
Sbjct: 101 RFFFQQLISGVNYCHSLQICHRDLK 125


>At1g78290.1 68414.m09123 serine/threonine protein kinase, putative
           similar to serine-threonine protein kinase [Triticum
           aestivum] gi|2055374|gb|AAB58348
          Length = 343

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    ++MN     HPN I+         +  +VM+Y    +LF  +   G  S    
Sbjct: 41  IDEHVQREIMNHRSLIHPNIIRFKEVLLTATHLALVMEYAAGGELFGRICSAGRFSEDEA 100

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   +N  H     H D+K
Sbjct: 101 RFFFQQLISGVNYCHSLQICHRDLK 125


>At1g68830.1 68414.m07870 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 562

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           E  ++++  I+RQL  AL+ LH    IH D+K
Sbjct: 250 ERENKIIQTIMRQLLFALDGLHSTGIIHRDVK 281


>At5g18190.1 68418.m02135 protein kinase family protein contains
           Pfam domains, PF00069: Protein kinase domain
          Length = 691

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 2/91 (2%)
 Frame = -3

Query: 268 NNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE- 95
           N+ G NF    E +V+  +N       ++      +  ++VMD +  P L++     G+ 
Sbjct: 172 NSKGCNFGPPYEWQVYNTLNGCYGVPAVHHKGRQGDFYILVMDMLG-PSLWDVWNSSGQS 230

Query: 94  LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +S  +V+ I  +    L  LH   F+H D+K
Sbjct: 231 MSPNMVACIAVESISILEKLHMKGFVHGDVK 261


>At4g36070.1 68417.m05135 calcium-dependent protein kinase family
           protein / CDPK family protein contains Pfam domains,
           PF00069: Protein kinase domain and PF00036: EF hand
          Length = 536

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 18/81 (22%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNII 65
           E+K+ Q +  H N +   F++ F +   I  VM+  D  +L + + +    + +  + ++
Sbjct: 119 EVKILQALGGHENVVG--FHNAFEDKTYIYIVMELCDGGELLDRI-LANRYTEKDAAVVV 175

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ +   + H    +H D+K
Sbjct: 176 RQMLKVAAECHLRGLVHRDMK 196


>At3g53930.1 68416.m05958 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 711

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPN---FIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           + EI + + +N HPN   FI +    G IN   +V++Y    DL   +   G +      
Sbjct: 65  MSEIIILRKIN-HPNIIRFIDMIEAPGKIN---LVLEYCKGGDLSMYIHKHGSVPEATAK 120

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           + + QL   L  L  +N IH D+K
Sbjct: 121 HFMLQLAAGLQVLRDNNIIHRDLK 144


>At3g46140.1 68416.m04993 protein kinase-related contains eukaryotic
           protein kinase domain, INTERPRO:IPR000719
          Length = 376

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  ++++Y     LF+ +    G LS + V  + R +   L+ +H+ N IH DIK
Sbjct: 173 NYNLILEYCSGKSLFDLVNDNLGGLSEKDVKLLARDILYGLDCIHRANIIHCDIK 227


>At3g17510.1 68416.m02237 CBL-interacting protein kinase 1 (CIPK1)
           identical to CBL-interacting protein kinase 1
           [Arabidopsis thaliana] gi|11066952|gb|AAG28776; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 1 (CIPK1) GI:11066951
          Length = 444

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 19/91 (20%), Positives = 43/91 (47%)
 Frame = -3

Query: 274 AENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE 95
           A+ NF       EI+  +++  HP+ ++++          +VM+ +   +LF+ +   G+
Sbjct: 57  ADLNFSLQIK-REIRTLKMLK-HPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGK 114

Query: 94  LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L+      + +QL + ++  H     H D+K
Sbjct: 115 LTETDGRKMFQQLIDGISYCHSKGVFHRDLK 145


>At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase, isoform AK1 (CDPK) [Arabidopsis thaliana]
           SWISS-PROT:Q06850; contains protein kinase domain,
           Pfam:PF00069; contains EF hand domain (calcium-binding
           EF-hand), Pfam:PF00036, INTERPRO:IPR002048
          Length = 583

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 17/79 (21%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   ++ HPN I+I   +       +VM+     +LF+ +  +G  + +  + + R 
Sbjct: 182 EIQIMHHLSGHPNVIQIVGAYEDAVAVHVVMEICAGGELFDRIIQRGHYTEKKAAELARI 241

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 242 IVGVIEACHSLGVMHRDLK 260


>At4g33950.1 68417.m04818 protein kinase, putative similar to
           abscisic acid-activated protein kinase [Vicia faba]
           gi|6739629|gb|AAF27340; contains protein kinase domain,
           Pfam:PF00069
          Length = 362

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 21/79 (26%), Positives = 33/79 (41%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI  H+ +  HPN ++         +  IVM+Y    +LFE +   G  S        +Q
Sbjct: 65  EIINHRSLR-HPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQ 123

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 124 LISGVSYCHAMQVCHRDLK 142


>At3g13670.1 68416.m01722 protein kinase family protein contains
           Pfam domains, PF00069: Protein kinase domain
          Length = 703

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = -3

Query: 259 GANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSH 86
           G N+    E +V+  +       +++F     +  V+VMD +  P L++     G+ +S 
Sbjct: 183 GCNYGPPHEWQVYNTLGGSHGVPRVHFKGRQGDYYVMVMDMLG-PSLWDLWNTSGQAMSS 241

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++V+ I  +    L  +H   ++H D+K
Sbjct: 242 EMVACIAVESLSILEKMHAKGYVHGDVK 269


>At1g12580.1 68414.m01461 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069; contains similarity
           to calcium-dependent protein kinase GI:5162877 from
           [Marchantia polymorpha]
          Length = 522

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 17/79 (21%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI +   +  HPN + +   +   ++  +VM+     +LF  L+  G  S      + + 
Sbjct: 92  EIAIMAKLAGHPNVVNLKAVYEEKDSVHLVMELCAGGELFHKLEKYGRYSEVRARVLFKH 151

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L + +   H    +H D+K
Sbjct: 152 LMQVVKFCHDSGIVHRDLK 170


>At5g63650.1 68418.m07991 serine/threonine protein kinase, putative
           similar to serine/threonine-protein kinase
           ASK2[Arabidopsis thaliana], SWISS-PROT:P43292; contains
           protein kinase domain, Pfam:PF00069
          Length = 360

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    +++N     HPN I+         +  IVM+Y    +LFE +   G  S    
Sbjct: 41  IDENVAREIINHRSLRHPNIIRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEA 100

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   ++  H     H D+K
Sbjct: 101 RYFFQQLICGVDYCHSLQICHRDLK 125


>At5g55090.1 68418.m06867 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 448

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++M+Y+    L + ++  G +L   L+ +  RQ+ + L  LH    +H D+K
Sbjct: 78  LLMEYVSGGSLHDLIKNSGGKLPEPLIRSYTRQILKGLMYLHDQGIVHCDVK 129


>At5g04870.1 68418.m00510 calcium-dependent protein kinase isoform
           AK1 (AK1) identical to calcium-dependent protein kinase,
           isoform AK1 (CDPK) [Arabidopsis thaliana]
           SWISS-PROT:Q06850; contains protein kinase domain,
           Pfam:PF00069; contains EF hand domain (calcium-binding
           EF-hand), Pfam:PF00036, INTERPRO:IPR002048
          Length = 610

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/79 (21%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  HPN I I   +  +    +VM+     +LF+ +  +G  + +  + + R 
Sbjct: 198 EIQIMHHLAGHPNVISIKGAYEDVVAVHLVMECCAGGELFDRIIQRGHYTERKAAELTRT 257

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 258 IVGVVEACHSLGVMHRDLK 276


>At4g13020.2 68417.m02032 serine/threonine protein kinase (MHK)
           identical to serine/threonine-protein kinase MHK
           [Arabidopsis thaliana] SWISS-PROT:P43294
          Length = 443

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSN 71
           N+ E+K  + +N HP+ IK+       N    + + +D  +L+  ++ +    S   + +
Sbjct: 55  NLREVKALRKLN-HPHIIKLKEIVREHNELFFIFECMD-HNLYHIMKERERPFSEGEIRS 112

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
            + Q+ + L  +HK+ + H D+K
Sbjct: 113 FMSQMLQGLAHMHKNGYFHRDLK 135


>At4g13020.1 68417.m02031 serine/threonine protein kinase (MHK)
           identical to serine/threonine-protein kinase MHK
           [Arabidopsis thaliana] SWISS-PROT:P43294
          Length = 435

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSN 71
           N+ E+K  + +N HP+ IK+       N    + + +D  +L+  ++ +    S   + +
Sbjct: 47  NLREVKALRKLN-HPHIIKLKEIVREHNELFFIFECMD-HNLYHIMKERERPFSEGEIRS 104

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
            + Q+ + L  +HK+ + H D+K
Sbjct: 105 FMSQMLQGLAHMHKNGYFHRDLK 127


>At4g12020.1 68417.m01912 protein kinase family protein similar to
            mitogen-activated protein kinase [Arabidopsis thaliana]
            GI:1255448; contains Pfam profiles PF02671: Paired
            amphipathic helix repeat, PF03106: WRKY DNA-binding
            domain, PF00560: Leucine Rich Repeat, PF00069: Protein
            kinase domain, PF00931: NB-ARC domain
          Length = 1798

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            H N ++        +N  I ++ +    L +  Q + +L   +VS   RQ+ + L  LH 
Sbjct: 1684 HQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQ-RNQLGDSVVSLYTRQILDGLKYLHD 1742

Query: 28   HNFIHNDIK 2
              FIH +IK
Sbjct: 1743 KGFIHRNIK 1751


>At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 575

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ--IKGE--LSHQLVSN 71
           EI++   ++  PN ++I  ++   N+  IVM+     +LF+ +   +K     S +  + 
Sbjct: 70  EIQIMDHVSGQPNIVQIKGSYEDNNSIHIVMELCGGGELFDKIDALVKSHSYYSEKDAAG 129

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I R +  A+   H  + +H D+K
Sbjct: 130 IFRSIVNAVKICHSLDVVHRDLK 152


>At1g69220.2 68414.m07926 serine/threonine protein kinase, putative
           identical to serine/threonine kinase [Arabidopsis
           thaliana] gi|2352084|gb|AAB68776
          Length = 809

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIR 62
           EI++ Q  N HPN ++   ++   +   IVM+Y     + + + +  E L    ++ I R
Sbjct: 268 EIEMLQQCN-HPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICR 326

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +  + L  LH    +H DIK
Sbjct: 327 EALKGLAYLHSIYKVHRDIK 346


>At1g69220.1 68414.m07925 serine/threonine protein kinase, putative
           identical to serine/threonine kinase [Arabidopsis
           thaliana] gi|2352084|gb|AAB68776
          Length = 836

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIR 62
           EI++ Q  N HPN ++   ++   +   IVM+Y     + + + +  E L    ++ I R
Sbjct: 295 EIEMLQQCN-HPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICR 353

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +  + L  LH    +H DIK
Sbjct: 354 EALKGLAYLHSIYKVHRDIK 373


>At1g53165.1 68414.m06023 protein kinase, putative similar to
           serine/threonine protein kinase 24 [Homo sapiens]
           SWISS-PROT:Q9Y6E0
          Length = 1007

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+M+Y+    + + LQ    L    ++ I R L  A+  LH    IH DIK
Sbjct: 415 IIMEYMAGGSVADLLQPGNPLDEISIACITRDLLHAVEYLHAEGKIHRDIK 465


>At1g10940.1 68414.m01256 serine/threonine protein kinase, putative
           similar to serine/threonine-protein kinase ASK1
           [Arabidopsis thaliana] SWISS-PROT:P43291
          Length = 363

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    +++N     HPN I+         +  I M+Y    +LFE +   G  S    
Sbjct: 41  IDENVAREIINHRSLRHPNIIRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEA 100

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   ++  H     H D+K
Sbjct: 101 RYFFQQLISGVSYCHAMQICHRDLK 125


>At5g66880.1 68418.m08431 serine/threonine protein kinase, putative
           similar to serine-threonine protein kinase [Triticum
           aestivum] gi|2055374|gb|AAB58348
          Length = 361

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 19/79 (24%), Positives = 33/79 (41%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI  H+ +  HPN ++         +  I+M+Y    +L+E +   G  S        +Q
Sbjct: 66  EIINHRSLR-HPNIVRFKEVILTPTHLAIIMEYASGGELYERICNAGRFSEDEARFFFQQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 125 LLSGVSYCHSMQICHRDLK 143


>At5g08590.1 68418.m01022 serine/threonine protein kinase (ASK2)
           identical to serine/threonine-protein kinase ASK2,
           SWISS-PROT: P43292; contains protein kinase domain,
           Pfam:PF00069
          Length = 353

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    +++N     HPN I+         +  IVM+Y    +LF+ +   G  S    
Sbjct: 41  IDENVAREIINHRSLKHPNIIRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEA 100

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   ++  H     H D+K
Sbjct: 101 RYFFQQLICGVDYCHSLQICHRDLK 125


>At4g35780.1 68417.m05080 protein kinase family protein similar to
           protein kinase [gi:170047] from Glycine max,
           [gi:13124865] from Arachis hypogaea; contains Pfam
           protein kinase domain PF00069
          Length = 570

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  IV +++    +++ L + KG    Q +  +   + + +N LH++N IH D+K
Sbjct: 361 NLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLK 415


>At4g04700.1 68417.m00690 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423;
           contains protein kinase domain, Pfam:PF00069
          Length = 485

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 17/83 (20%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL----QIKGELSHQLVSN 71
           EI++ + ++  PN ++    +   ++  IVM+Y    +L++ +     +    S +  + 
Sbjct: 76  EIRIMKQLSGEPNIVEFKNAYEDKDSVHIVMEYCGGGELYDKILALYDVGKSYSEKEAAG 135

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           IIR +   + + H    +H D+K
Sbjct: 136 IIRSIVNVVKNCHYMGVMHRDLK 158


>At3g50530.1 68416.m05526 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase CaMK3 [Nicotiana tabacum]
           gi|16904226|gb|AAL30820
          Length = 601

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 16/80 (20%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIR 62
           E+K+ + ++ H N    Y  +   +N  IVM+  +  +L + +  + G+ + +    ++ 
Sbjct: 199 EVKILRALSGHNNLPHFYDAYEDHDNVYIVMELCEGGELLDRILSRGGKYTEEDAKTVMI 258

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   +   H    +H D+K
Sbjct: 259 QILNVVAFCHLQGVVHRDLK 278


>At2g40580.1 68415.m05006 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 311

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I M+Y    +L + +    G LS   V    R + + L  LH   F+H D+K
Sbjct: 90  IYMEYASLGNLNKMISDAGGRLSEDSVRRATRMILQGLKALHSEGFVHCDLK 141


>At2g40560.1 68415.m05004 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 303

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 8/87 (9%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFI----KIYFNHGFINNQVIVMDYIDCPDLFETL---QIKGE-LSHQ 83
           E+++     DHP  +    K++          I M+Y    +L   +   + K E +   
Sbjct: 60  ELRIMHRFRDHPRIVQASNKLHLQIQPYEYCYIYMEYASKGNLHRFIYGFRRKEEPIPES 119

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
           LVS   R + E L  LH H +++ D+K
Sbjct: 120 LVSRTARMILEGLEALHSHGYVYCDLK 146


>At1g60940.2 68414.m06860 serine/threonine protein kinase, putative
           similar to serine/threonine-protein kinase ASK1 from
           [Arabidopsis thaliana], SWISS-PROT:P43291
          Length = 361

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    +++N     HPN I+         +  I M+Y    +LFE +   G  S    
Sbjct: 41  IDENVAREIINHRSLRHPNIIRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEA 100

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   ++  H     H D+K
Sbjct: 101 RYFFQQLISGVSYCHAMQICHRDLK 125


>At1g60940.1 68414.m06859 serine/threonine protein kinase, putative
           similar to serine/threonine-protein kinase ASK1 from
           [Arabidopsis thaliana], SWISS-PROT:P43291
          Length = 361

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    +++N     HPN I+         +  I M+Y    +LFE +   G  S    
Sbjct: 41  IDENVAREIINHRSLRHPNIIRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEA 100

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   ++  H     H D+K
Sbjct: 101 RYFFQQLISGVSYCHAMQICHRDLK 125


>At1g51660.1 68414.m05820 mitogen-activated protein kinase kinase
           (MAPKK), putative (MKK4) identical to MAP kinase kinase
           4 [Arabidopsis thaliana] gi|3219271|dbj|BAA28830
           gi_13265419
          Length = 366

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ + +N HPN +K +          ++++++D   L E   +  E   Q ++++ RQ
Sbjct: 125 EIEILRDVN-HPNVVKCHEMFDQNGEIQVLLEFMDKGSL-EGAHVWKE---QQLADLSRQ 179

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LH  + +H DIK
Sbjct: 180 ILSGLAYLHSRHIVHRDIK 198


>At3g50500.1 68416.m05523 protein kinase, putative similar to
           abscisic acid-activated protein kinase [Vicia faba]
           gi|6739629|gb|AAF27340
          Length = 362

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 20/79 (25%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI  H+ +  HPN ++        ++  IVM+Y    +L+E +   G  S        +Q
Sbjct: 67  EIINHRSLR-HPNIVRFKEVILTPSHLAIVMEYAAGGELYERICNAGRFSEDEARFFFQQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 126 LISGVSYCHAMQICHRDLK 144


>At3g03940.1 68416.m00412 protein kinase family protein contains
           Pfam domains, PF00069: Protein kinase domain
          Length = 701

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 2/91 (2%)
 Frame = -3

Query: 268 NNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGE 95
           N+ G NF    E +V+  +N       ++      +  ++VMD +  P L++    +   
Sbjct: 182 NSKGCNFGPPYEWQVYNTLNSCYGIPAVHHKGRQGDFYILVMDMLG-PSLWDVWNSLAQS 240

Query: 94  LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +S  +V+ I  +    L  LH   F+H D+K
Sbjct: 241 MSPNMVACIAVEAISILEKLHMKGFVHGDVK 271


>At4g26890.1 68417.m03869 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 444

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = -3

Query: 181 NHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           ++G + N  I+M+Y+   +L + ++  G +L    + +  RQ+   L  LH+   +H D+
Sbjct: 70  SNGLVYN--ILMEYVSGGNLHDLIKNSGGKLPEPEIRSYTRQILNGLVYLHERGIVHCDL 127

Query: 4   K 2
           K
Sbjct: 128 K 128


>At4g22940.1 68417.m03312 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 458

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 5/75 (6%)
 Frame = -3

Query: 211 DHPNFIKI----YFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEA 47
           DHPN IK+      +H   +   ++ +Y++  DL     + G   S   V   +RQL   
Sbjct: 158 DHPNVIKLEGLMLVDHDS-STLYLIFEYME-HDLLGLSSLLGVHFSEPQVKCYMRQLLRG 215

Query: 46  LNDLHKHNFIHNDIK 2
           L+  H ++ +H D+K
Sbjct: 216 LDHCHTNHVLHRDMK 230


>At4g21370.1 68417.m03088 S-locus protein kinase, putative similar
           to SRKa [Arabidopsis lyrata] gi|13620927|dbj|BAB40986;
           contains Pfam domains PF00954: S-locus glycoprotein
           family, PF00069: Protein kinase domain and PF01453:
           Lectin (probable mannose binding)
          Length = 844

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 7/93 (7%)
 Frame = -3

Query: 259 GANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDL----FETLQIKGEL 92
           G N   +E+++   +  H N +++     + + ++++ +Y++   L    FET Q   +L
Sbjct: 553 GTNEFKNEVRLIARLQ-HINLVRLLSCCIYADEKILIYEYLENGSLDSHLFETTQSSNKL 611

Query: 91  SHQLVSNIIRQLCEALNDLH---KHNFIHNDIK 2
           + Q   +II  +   L  LH   +   IH D+K
Sbjct: 612 NWQTRFSIINGIARGLLYLHQDSRFKIIHRDLK 644


>At2g41930.1 68415.m05187 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 347

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +LS  ++ +  R + + L  +H H ++H D+K
Sbjct: 101 KLSDSVIKDFTRMILQGLVSIHNHGYVHCDLK 132


>At2g34290.1 68415.m04195 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 265

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +L   ++    R L E L  +H+H ++H D+K
Sbjct: 101 KLPDPMIRKFTRMLLEGLATIHRHGYVHCDLK 132


>At2g31010.1 68415.m03781 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 775

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 12/54 (22%), Positives = 28/54 (51%), Gaps = 3/54 (5%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGE---LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +Y++   L+  + + G+   LS      ++R +C  L  +H+   +H D+K
Sbjct: 591 MITEYMELGSLYYLIHMSGQKKKLSWHRRLRMLRDICRGLMCIHRMKIVHRDLK 644


>At1g54610.1 68414.m06228 protein kinase family protein contains
           Pfam domain, PF00069: Protein kinase domain
          Length = 572

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 7/77 (9%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQV-----IVMDYID--CPDLFETLQIKGELSHQLVSNIIRQLC 53
           DHPN +K+    G + +++     +V  Y+D     L  +  +K   S   V  ++RQL 
Sbjct: 173 DHPNVVKL---EGLVTSRMSCSLYLVFQYMDHDLAGLASSPVVK--FSESEVKCLMRQLI 227

Query: 52  EALNDLHKHNFIHNDIK 2
             L   H    +H DIK
Sbjct: 228 SGLEHCHSRGVLHRDIK 244


>At3g45640.1 68416.m04929 mitogen-activated protein kinase, putative
           / MAPK, putative (MPK3) identical to mitogen-activated
           protein kinase homolog (AtMPK3)[Arabidopsis thaliana]
           SWISS-PROT:Q39023; PMID:12119167
          Length = 370

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 6/96 (6%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIY------FNHGFINNQVIVMDYIDCPDLFETL 110
           +N+  A   + EIK+ + + DH N I I           F  + V +   +   DL + +
Sbjct: 74  DNHMDAKRTLREIKLLRHL-DHENIIAIRDVVPPPLRRQF--SDVYISTELMDTDLHQII 130

Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +    LS +     + QL   L  +H  N IH D+K
Sbjct: 131 RSNQSLSEEHCQYFLYQLLRGLKYIHSANIIHRDLK 166


>At3g17750.1 68416.m02265 protein kinase family protein contains Pfam
            profile: PF00069 Eukaryotic protein kinase domain
          Length = 1138

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 11/93 (11%)
 Frame = -3

Query: 247  NVDEIKVHQLMNDHP-----NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ 83
            ++DEIK+ + +N H      + +++Y    F  + +IV + +   +L+E  +   E   +
Sbjct: 868  SLDEIKLLKYVNQHDPADKYHLLRLYDYFYFREHLLIVCELLKA-NLYEFQKFNRESGGE 926

Query: 82   L------VSNIIRQLCEALNDLHKHNFIHNDIK 2
            +      + +I  Q  EALN LH    IH D+K
Sbjct: 927  VYFTMPRLQSITIQCLEALNFLHGLGLIHCDLK 959


>At2g23080.2 68415.m02751 casein kinase II alpha chain, putative
           identical to probable casein kinase II, alpha chain
           [Arabidopsis thaliana] SWISS-PROT:O64817; similar to
           casein kinase II, alpha chain 1 [Arabidopsis thaliana]
           SWISS-PROT:Q08467
          Length = 307

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           EIK+ Q +   PN +K+Y            +V ++++  D F+ L     L+   +   I
Sbjct: 76  EIKILQNLCGGPNIVKLYDIVRDEHSKTPSLVFEFVNSVD-FKVLY--PTLTDYDIRYYI 132

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            +L +AL+  H    +H D+K
Sbjct: 133 YELLKALDFCHSQGIMHRDVK 153


>At2g23080.1 68415.m02752 casein kinase II alpha chain, putative
           identical to probable casein kinase II, alpha chain
           [Arabidopsis thaliana] SWISS-PROT:O64817; similar to
           casein kinase II, alpha chain 1 [Arabidopsis thaliana]
           SWISS-PROT:Q08467
          Length = 333

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           EIK+ Q +   PN +K+Y            +V ++++  D F+ L     L+   +   I
Sbjct: 76  EIKILQNLCGGPNIVKLYDIVRDEHSKTPSLVFEFVNSVD-FKVLY--PTLTDYDIRYYI 132

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            +L +AL+  H    +H D+K
Sbjct: 133 YELLKALDFCHSQGIMHRDVK 153


>At1g37130.1 68414.m04639 nitrate reductase 2 (NR2) identical to
           SP|P11035 Nitrate reductase 2 (formerly EC 1.6.6.1)
           (NR2) {Arabidopsis thaliana}
          Length = 917

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -3

Query: 196 IKIYFN--HGFINNQVIVMDYIDCPDLFETLQIKGELSH 86
           +KIYF   H    N  ++  Y+D   +  TL+IKG L H
Sbjct: 730 VKIYFGGVHPRFPNGGLMSQYLDSLPIGSTLEIKGPLGH 768


>At1g20930.1 68414.m02621 cell division control protein, putative
           cdc2MsF [Medicago sativa] gi|1806146|emb|CAA65982
          Length = 315

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 19/88 (21%), Positives = 42/88 (47%), Gaps = 9/88 (10%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQ-----VIVMDYIDCPDLFETLQIKGELSHQLVS 74
           EI + +++   P+ +++      IN +      +V +Y+D  DL + ++   +    +  
Sbjct: 63  EISILRMLARDPHIVRLMDVKQGINKEGKTVLYLVFEYVDT-DLKKFIRSFRQAGQNIPQ 121

Query: 73  NIIR----QLCEALNDLHKHNFIHNDIK 2
           N ++    QLC+ +   H H  +H D+K
Sbjct: 122 NTVKCLMYQLCKGMAFCHGHGVLHRDLK 149


>At5g27790.1 68418.m03332 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 327

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 18/76 (23%), Positives = 34/76 (44%), Gaps = 2/76 (2%)
 Frame = -3

Query: 223 QLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCE 50
           +++  + N +K  FN       +I M+Y     L   +    +  L   ++    R L E
Sbjct: 76  RIVQCYGNGVKQRFNDKGYVEYMIPMEYATGGSLNNFMDRFNDRKLPDPMIRKFTRMLLE 135

Query: 49  ALNDLHKHNFIHNDIK 2
            L  +H++ ++H DIK
Sbjct: 136 GLATIHRYGYVHYDIK 151


>At4g38470.1 68417.m05436 protein kinase family protein similar to
           protein kinase [gi:170047] from Glycine max; contains
           Pfam protein kinase domain PF00069
          Length = 575

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 13/52 (25%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IV +++    +++ L + KG      +  +   +C+ ++ LH++N IH D+K
Sbjct: 362 IVTEFMPGGSVYDYLHKQKGVFKLPTLFKVAIDICKGMSYLHQNNIIHRDLK 413


>At3g54180.1 68416.m05989 cell division control protein 2 homolog B
           (CDC2B) identical to cell division control protein 2
           homolog B [Arabidopsis thaliana] SWISS-PROT:P25859
          Length = 309

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 9/27 (33%), Positives = 16/27 (59%)
 Frame = -3

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L+  ++ QLC+ +   H H  +H D+K
Sbjct: 118 LIQKLMFQLCKGVAHCHSHGVLHRDLK 144


>At1g76540.1 68414.m08907 cell division control protein, putative
           similar to SWISS-PROT:Q38775, cell division control
           protein 2 homolog D [Antirrhinum majus]; contains
           protein kinase domain, Pfam:PF00069
          Length = 313

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 9/28 (32%), Positives = 17/28 (60%)
 Frame = -3

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           Q + +++ QLC+ +   H H  +H D+K
Sbjct: 120 QTIKSLMYQLCKGMAFCHGHGILHRDLK 147


>At5g41990.1 68418.m05112 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 563

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 4/73 (5%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVM--DYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           H N IK++++     N+ I M  +      L    +   ++  + + N  RQ+ + LN L
Sbjct: 87  HENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYL 146

Query: 34  HKHN--FIHNDIK 2
           H  N   IH D+K
Sbjct: 147 HSQNPPVIHRDLK 159


>At5g12090.1 68418.m01420 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 369

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +L   ++ +  R + E L  +H H ++H D+K
Sbjct: 131 KLPDPMIRDFTRMILEGLVSMHSHGYVHCDLK 162


>At5g05160.1 68418.m00549 leucine-rich repeat transmembrane protein
           kinase, putative 
          Length = 640

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 3/75 (4%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGE--LSHQLVSNIIRQLCEA 47
           +N H NF+ +   +   + +++V  Y+    LF  +   +G+  +  +    I     +A
Sbjct: 397 INQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKA 456

Query: 46  LNDLHKHNFIHNDIK 2
           ++ LH   F+H DIK
Sbjct: 457 ISYLHSLKFVHGDIK 471


>At3g59790.1 68416.m06672 mitogen-activated protein kinase, putative
           / MAPK, putative (MPK10) mitogen-activated protein
           kinase (MAPK)(AtMPK10), PMID:12119167
          Length = 393

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = -3

Query: 127 DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           DL+ TL+   EL+       + Q+   L  +H  N +H D+K
Sbjct: 147 DLYRTLKSDQELTKDHGMYFMYQILRGLKYIHSANVLHRDLK 188


>At3g17510.2 68416.m02236 CBL-interacting protein kinase 1 (CIPK1)
           identical to CBL-interacting protein kinase 1
           [Arabidopsis thaliana] gi|11066952|gb|AAG28776; contains
           Pfam profiles PF00069: Protein kinase domain and
           PF03822: NAF domain; identical to cDNA CBL-interacting
           protein kinase 1 (CIPK1) GI:11066951
          Length = 364

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 12/51 (23%), Positives = 26/51 (50%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +   +LF+ +   G+L+      + +QL + ++  H     H D+K
Sbjct: 15  MVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLK 65


>At2g18170.1 68415.m02114 mitogen-activated protein kinase, putative
           / MAPK, putative (MPK7) identical to mitogen-activated
           protein kinase homolog 7 (AtMPK7)[Arabidopsis thaliana]
           SWISS-PROT:Q39027; PMID:12119167
          Length = 368

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 16/60 (26%), Positives = 26/60 (43%)
 Frame = -3

Query: 181 NHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N     +  +V + +D  DL + ++    LS       + QL   L  LH  N +H D+K
Sbjct: 102 NRSSFKDVYLVYELMDT-DLHQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLK 160


>At1g28570.2 68414.m03518 GDSL-motif lipase, putative similar to
           lipase [Arabidopsis thaliana] GI:1145627; contains
           InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L
           family
          Length = 317

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 3/35 (8%)
 Frame = -3

Query: 187 YFNH--GFINNQVIVMDYIDCPDLFE-TLQIKGEL 92
           +F+H  G  +N  +++D+IDC D+ E +L + GE+
Sbjct: 69  FFHHPTGRFSNGRLIIDFIDCRDMIENSLILMGEI 103


>At2g25760.2 68415.m03092 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 676

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 19/88 (21%), Positives = 41/88 (46%), Gaps = 2/88 (2%)
 Frame = -3

Query: 259 GANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSH 86
           G N+    E +V+  +       +++F     +  V+VMD +  P L++      + +S 
Sbjct: 154 GCNYGPPYEWQVYNALGGSHGVPRVHFKGRQGDFYVMVMDILG-PSLWDVWNSTTQAMST 212

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++V+ I  +    L  +H   ++H D+K
Sbjct: 213 EMVACIAIEAISILEKMHSRGYVHGDVK 240


>At2g25760.1 68415.m03091 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 673

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 19/88 (21%), Positives = 41/88 (46%), Gaps = 2/88 (2%)
 Frame = -3

Query: 259 GANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSH 86
           G N+    E +V+  +       +++F     +  V+VMD +  P L++      + +S 
Sbjct: 154 GCNYGPPYEWQVYNALGGSHGVPRVHFKGRQGDFYVMVMDILG-PSLWDVWNSTTQAMST 212

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++V+ I  +    L  +H   ++H D+K
Sbjct: 213 EMVACIAIEAISILEKMHSRGYVHGDVK 240


>At2g17170.1 68415.m01983 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069; weak similarity to
           Protein kinase APK1A (EC 2.7.1.-) (Swiss-Prot:Q06548)
           [Arabidopsis thaliana]
          Length = 328

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 4/86 (4%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIK---IYFNHGFINNQVIVMDYIDCPDLF-ETLQIKGELSH 86
           NF+ DEI + +   +  N +    +  N GF+  +       D PD F E  +  GEL H
Sbjct: 51  NFSSDEI-ISENAEESSNVVYKGCLLENLGFVAVKRFKNTPWDDPDYFTEDAKTAGELKH 109

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHND 8
           + +  ++   CE    L    F+ ND
Sbjct: 110 KRLVKLLGYCCEEDEGLLVAEFMPND 135


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,442,841
Number of Sequences: 28952
Number of extensions: 311983
Number of successful extensions: 1406
Number of sequences better than 10.0: 190
Number of HSP's better than 10.0 without gapping: 1236
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1398
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1843581600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -