SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g06120.1 68418.m00680 Ran-binding protein, putative similar t...    27   9.9  
At3g63100.1 68416.m07087 glycine-rich protein                          27   9.9  

>At5g06120.1 68418.m00680 Ran-binding protein, putative similar to
           SP|Q9UIA9 Ran-binding protein 16 {Homo sapiens};
           contains Pfam profile PF03810: Importin-beta N-terminal
           domain
          Length = 1066

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 442 SPASSTLLKCSVRIGLINTHSYTSSALRIVFLA 344
           SP S   L+C VR+  +    +T+ A R  FLA
Sbjct: 267 SPLSKEALECLVRLASVRRSLFTNDATRSNFLA 299


>At3g63100.1 68416.m07087 glycine-rich protein 
          Length = 199

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%)
 Frame = +2

Query: 425 RRRGWRTQHGRFKDHHR-YGHQVH 493
           RR G   +HGR + HHR +GH  H
Sbjct: 107 RRHGRDHRHGRDRGHHRGHGHHHH 130


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,988,420
Number of Sequences: 28952
Number of extensions: 270208
Number of successful extensions: 590
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 572
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 590
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1643603136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -