SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120041.Seq
         (827 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ...    30   2.2  
At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ...    30   2.2  
At3g51440.1 68416.m05634 strictosidine synthase family protein s...    29   2.8  
At2g32910.1 68415.m04035 expressed protein                             29   2.8  
At5g45220.1 68418.m05550 Toll-Interleukin-Resistance (TIR) domai...    28   6.6  
At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR...    28   6.6  

>At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative
           (UBP27) similar to GI:11993494; ubiquitin specific
           protease 66 - Gallus gallus,PID:g3800764
          Length = 361

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +2

Query: 311 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 433
           R ++ + T+Y + FNL S   A + + HLI + +E + V+C
Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186


>At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative
           (UBP27) similar to GI:11993494; ubiquitin specific
           protease 66 - Gallus gallus,PID:g3800764
          Length = 494

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +2

Query: 311 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 433
           R ++ + T+Y + FNL S   A + + HLI + +E + V+C
Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186


>At3g51440.1 68416.m05634 strictosidine synthase family protein
           similar to hemomucin [Drosophila
           melanogaster][GI:1280434], strictosidine synthase
           [Rauvolfia serpentina][SP|P15324]; contains
           strictosidine synthase domain PF03088
          Length = 371

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +3

Query: 156 AYHDDGWFI---CNSHLIKRFKMSKMVLPIFDEDDNNSK*RSLGI*LEIKKEV 305
           AYH+D  FI   C    +KR K+++ V     ED  N+  R LGI   I  EV
Sbjct: 74  AYHEDSGFIYTGCVDGWVKRVKVAESVNDSLVEDLVNTGGRPLGIAFGIHGEV 126


>At2g32910.1 68415.m04035 expressed protein 
          Length = 691

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +3

Query: 153 DAYHDDGWFICNSHLIKRFKMSKMVLPIFDEDDNNSK 263
           D+Y  D ++IC  H ++R   + MV P   +DD  S+
Sbjct: 610 DSYRRDPYYICERHALERPPRTYMVSPGRQDDDLYSR 646


>At5g45220.1 68418.m05550 Toll-Interleukin-Resistance (TIR)
           domain-containing protein domain signature TIR exists,
           suggestive of a disease resistance protein.
          Length = 546

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +3

Query: 612 GDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCI--IDETGL 752
           GDQL NN+ G+L + +RR+    +  ID +E R  +  T    I+++G+
Sbjct: 339 GDQLRNNFVGYLVDALRRSEINVF--IDNQEQRGEDLNTLFKRIEDSGI 385


>At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1017

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +2

Query: 458 SQAARNALYTAFTQLQ-EHSRHHKPEHVLFACVARRIAFFRRDQR 589
           S A+R + Y  F   + E +RH    H+  A  +R IA F+ D+R
Sbjct: 4   SSASRASSYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKR 48


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,964,700
Number of Sequences: 28952
Number of extensions: 363631
Number of successful extensions: 866
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 851
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 866
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1902108000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -