SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g45310.1 68418.m05562 expressed protein                             35   0.051
At5g07380.1 68418.m00845 hypothetical protein                          31   1.1  
At2g44400.1 68415.m05522 DC1 domain-containing protein  similar ...    31   1.1  
At1g09790.1 68414.m01098 phytochelatin synthetase-related contai...    29   2.5  
At5g45790.1 68418.m05631 expressed protein  ; expression support...    29   3.3  
At5g41940.1 68418.m05106 RabGAP/TBC domain-containing protein si...    29   4.4  
At4g24530.1 68417.m03516 expressed protein contains Pfam PF03138...    29   4.4  
At2g25320.1 68415.m03029 meprin and TRAF homology domain-contain...    29   4.4  
At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR016...    29   4.4  
At4g21130.1 68417.m03055 transducin family protein / WD-40 repea...    28   5.8  
At3g49350.1 68416.m05395 RabGAP/TBC domain-containing protein si...    28   5.8  
At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A)            28   5.8  
At5g15630.1 68418.m01829 phytochelatin synthetase family protein...    28   7.7  
At2g22630.1 68415.m02682 MADS-box protein (AGL17) nearly identic...    28   7.7  

>At5g45310.1 68418.m05562 expressed protein
          Length = 352

 Score = 35.1 bits (77), Expect = 0.051
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 5/76 (6%)
 Frame = +2

Query: 248 EQHLRDRIKSK--VDEQFDQLEREYSD---KIDGFHDNIQYFKDEHYSVSCQNGSVLKSK 412
           E++LR+ IK    +++  D+LE E+ +   KI+     +Q  K+E+  +   NG   +SK
Sbjct: 111 EKNLREAIKEYRIMEQDLDELEDEHDEAISKIEKLEAELQELKEENLQLMEVNGKDYRSK 170

Query: 413 FAKILKSHDYTDKKSI 460
             K+  S + ++ +SI
Sbjct: 171 KGKVKPSEEPSEIRSI 186


>At5g07380.1 68418.m00845 hypothetical protein 
          Length = 595

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +1

Query: 517 VAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGL 642
           + +C +     +G++Q L F Y P GN  +  F H IN   L
Sbjct: 45  IGLCYILKDRISGNDQQLKFAYTPTGNFCLRDFHHAINSLPL 86


>At2g44400.1 68415.m05522 DC1 domain-containing protein  similar to
           GP|2435515|AF024504
          Length = 146

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = -3

Query: 566 TWLLPFSNPGFNTHTAT*QCCVCRPIGANS 477
           T+ +P   PG +   ++ QCCVCR +G+NS
Sbjct: 103 TFSMPPGGPG-SAAASSFQCCVCRGLGSNS 131


>At1g09790.1 68414.m01098 phytochelatin synthetase-related contains
           Pfam profile PF04833: Phytochelatin synthetase-like
           conserved region
          Length = 454

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +1

Query: 529 VLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDGK 693
           VL P  ++   QV SF Y     K + P+ + INDTG++ + V  Y D +  +GK
Sbjct: 328 VLHPNLKS-VQQVFSFNY-----KSLTPYQNSINDTGMF-WGVQFYNDVLLQEGK 375


>At5g45790.1 68418.m05631 expressed protein  ; expression supported
           by MPSS
          Length = 423

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 2/37 (5%)
 Frame = +3

Query: 66  CKMCVIFPVEIDVSQTVIRDCHVD--EQTRELVYINK 170
           CK+   F V ID  + V+R+C VD  ++ ++L+ ++K
Sbjct: 129 CKITEKFKVLIDEEENVVRECEVDAVKRVKKLLLLSK 165


>At5g41940.1 68418.m05106 RabGAP/TBC domain-containing protein
           similar to GTPase activating protein [Yarrowia
           lipolytica] GI:2370595; contains Pfam profile PF00566:
           TBC domain
          Length = 549

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = -2

Query: 657 DVVLVKSRVVNFVSKRHNNFVTNRVVLKR*-HLVAAVLKSRLQHAYRHV 514
           D VL     V F+SK  +NF  + V ++R   +V+ ++K +  H YRH+
Sbjct: 380 DDVLAFWCFVGFMSKARHNFRLDEVGIRRQLSMVSKIIKFKDIHLYRHL 428


>At4g24530.1 68417.m03516 expressed protein contains Pfam PF03138:
           Plant protein family. The function of this family of
           plant proteins is unknown; previously annotated as
           'PsRT17-1 like protein'  based on similarity to PsRT17-1
           (GP:1778376) [Pisum sativum] which was based upon
           similarity to axi 1 protein (GB:X80301) (GI:559920) from
           [Nicotiana tabacum], which, due to scienitific fraud was
           retracted. Retraction in: Schell J. EMBO J 1999 May
           17;18(10):2908. PMID:10400497.
          Length = 519

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/43 (41%), Positives = 20/43 (46%)
 Frame = -3

Query: 407 FSTRCHFGNLPNSVHL*NTGCYREIHQFYRCIRVLVDQIVHRL 279
           FS R  F NLP S+         E   F   IR L D +VHRL
Sbjct: 226 FSHRLAFDNLPESIQRLRCKVNFEALNFVPHIRELGDALVHRL 268


>At2g25320.1 68415.m03029 meprin and TRAF homology domain-containing
            protein / MATH domain-containing protein weak similarity
            to  ubiquitin-specific protease 12 [Arabidopsis thaliana]
            GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 1663

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 11/40 (27%), Positives = 23/40 (57%)
 Frame = +2

Query: 224  SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHD 343
            S T++ ++ +    R+KS++  + D+  RE  D ++ F D
Sbjct: 1376 SITQKLSESEAANTRLKSEMKAEADRFSREKKDLVEQFRD 1415


>At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR01612:
           reticulocyte binding protein; similar to  Myosin heavy
           chain, non-muscle (Zipper protein) (Myosin II)
           (SP:Q99323) {Drosophila melanogaster} similar to EST
           gb|T76116
          Length = 1730

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = +2

Query: 248 EQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFK 361
           E H    I   VD  FD++E++  D  D  + N + F+
Sbjct: 617 EDHTSSDINLLVDRSFDKIEKQIRDSSDSSYGNEEIFE 654


>At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400); some
           similarity to a group of proteins with homology to
           mammalian apoptosis regulators identified in zebrafish
           (PUBMED:10917738)Apaf-1(gi:7677507)
          Length = 537

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%)
 Frame = +3

Query: 123 DCHV---DEQTRELVYINKIMNTQLTKPVLMMF 212
           DCHV   D +TRE V +NK+ N Q+   V   F
Sbjct: 227 DCHVHLWDIRTREHVQVNKLKNNQVKDSVHCAF 259


>At3g49350.1 68416.m05395 RabGAP/TBC domain-containing protein
           similar to GTPase activating protein [Yarrowia
           lipolytica] GI:2370595; contains Pfam profile PF00566:
           TBC domain
          Length = 554

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = -2

Query: 630 VNFVSKRHNNFVTNRVVLKR*-HLVAAVLKSRLQHAYRHVAVL 505
           V F+ K  +NF  + V ++R  ++V+ ++KS+    YRH+  L
Sbjct: 389 VGFMKKARHNFRLDEVGIRRQLNIVSKIIKSKDSQLYRHLEKL 431


>At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A)
          Length = 135

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = +3

Query: 483 CPNWSTNTTLLRG 521
           CP WS NT LLRG
Sbjct: 76  CPTWSENTVLLRG 88


>At5g15630.1 68418.m01829 phytochelatin synthetase family protein /
           COBRA cell expansion protein COBL4 similar to
           phytochelatin synthetase [Hordeum vulgare subsp.
           vulgare] GI:29570314; identified in Roudier, et al,
           Plant Phys. (2002) 130:538-548 (PMID:12376623); contains
           Pfam profile PF04833: Phytochelatin synthetase-like
           conserved region
          Length = 431

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 20/67 (29%), Positives = 29/67 (43%)
 Frame = +1

Query: 472 KILFAPIGRQTQHCYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEY 651
           KI       +  H    + +  P   N + QV SF+Y P+      P+   INDTG++ Y
Sbjct: 295 KIAITNFNYRMNHTLWTLAIQHPNLNNVT-QVFSFDYKPVS-----PYG-SINDTGMF-Y 346

Query: 652 DVLAYVD 672
               Y D
Sbjct: 347 GTKFYND 353


>At2g22630.1 68415.m02682 MADS-box protein (AGL17) nearly identical
           to MADS-box protein AGL17 [Arabidopsis thaliana]
           GI:862648
          Length = 227

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 18/61 (29%), Positives = 27/61 (44%)
 Frame = -3

Query: 227 RTRNVKHHENGFCQLRVHNLVNVHQLSGLFVHMTISNNRLGHVDFYRKNYTHFAMVKLKC 48
           R RN+ HHEN     +V  +   +       + T + N LGH +     Y   A V+L+ 
Sbjct: 154 RKRNLVHHENLELSRKVQRIHQENVELYKKAYGTSNTNGLGHHELVDAVYESHAQVRLQL 213

Query: 47  S 45
           S
Sbjct: 214 S 214


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,443,356
Number of Sequences: 28952
Number of extensions: 316986
Number of successful extensions: 943
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 920
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 943
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1682736544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -