SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g66235.1 68414.m07518 expressed protein ; expression supporte...    31   0.70 
At1g19220.1 68414.m02392 transcriptional factor B3 family protei...    30   1.6  
At1g03270.1 68414.m00305 expressed protein contains Pfam profile...    29   2.1  
At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA he...    29   2.8  
At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-g...    28   4.9  
At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)...    27   8.6  

>At1g66235.1 68414.m07518 expressed protein ; expression supported
           by MPSS
          Length = 265

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 32/113 (28%), Positives = 57/113 (50%), Gaps = 2/113 (1%)
 Frame = +3

Query: 135 IDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMPLRNQQFKQM 314
           I +S  Q  ++  K+K + KN Q +LD+I  F +GNK      + + KK   + QQ+ +M
Sbjct: 154 IGRSPYQRPIRVKKSKLKRKNDQ-ILDVIKTFEEGNKQL----MEQLKKTSAQRQQYLEM 208

Query: 315 -GKFQQLR-KKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQMTAT 467
             K   LR +K + ++L   + S ++ +L    Q +   +  LR +  Q  A+
Sbjct: 209 QSKSLALREQKEENKVLYRNLNSIEDPNLRAYLQSEQAKI--LRKRLDQQAAS 259


>At1g19220.1 68414.m02392 transcriptional factor B3 family protein /
           auxin-responsive factor AUX/IAA-related contains Pfam
           profile: PF02309 AUX/IAA family
          Length = 1086

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 19/75 (25%), Positives = 38/75 (50%)
 Frame = +3

Query: 108 SLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMP 287
           S +H   + + ++  Q  M++  +KP + +QQ  L ++ K  Q  + ++  PV+ + +  
Sbjct: 615 SSLHSLQQNLSQNPQQLQMQQQSSKP-SPSQQLQLQLLQKLQQQQQQQSIPPVSSSLQPQ 673

Query: 288 LRNQQFKQMGKFQQL 332
           L   Q  Q  + QQL
Sbjct: 674 LSALQQTQSHQLQQL 688


>At1g03270.1 68414.m00305 expressed protein contains Pfam profile
           PF01595: Domain of unknown function
          Length = 499

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 2/98 (2%)
 Frame = +3

Query: 183 PRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKL-KVQIL 359
           PR  +   L DI+ +F +G+   A V   + K     N Q    G+  +   K  +   L
Sbjct: 300 PRVPSDMPLYDILNEFQKGSSHMAAVVKVKDKDKK-NNMQLLSNGETPKENMKFYQSSNL 358

Query: 360 VAPMMSHQNRHLSPTKQLKNLTLH-QLRNKNHQMTATV 470
            AP++ H++  +     +  +  H + R +N Q   TV
Sbjct: 359 TAPLLKHESHDV--VVDIDKVPKHVKNRGRNFQQNGTV 394


>At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA
           helicase -Mus musculus,PIR2:I84741
          Length = 621

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 12/41 (29%), Positives = 18/41 (43%)
 Frame = +2

Query: 296 PTIQTNGKVPATKKKAEXXXXXXXXXEPPKQASKPNQAVKK 418
           P   T GK P  K  +           PP+++SKP + + K
Sbjct: 543 PARSTGGKTPVRKSSSSSFSKPRKASSPPEKSSKPKRKILK 583


>At1g69830.1 68414.m08034 alpha-amylase, putative /
           1,4-alpha-D-glucan glucanohydrolase, putative similar to
           SP|P17859 Alpha-amylase precursor (EC 3.2.1.1)
           (1,4-alpha-D-glucan glucanohydrolase) {Vigna mungo},
           alpha-amylase [Malus x domestica] GI:7532799; contains
           Pfam profile PF00128: Alpha amylase, catalytic domain
          Length = 887

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%)
 Frame = +2

Query: 530 YVHHKKK--RNHQMTIVVMMNLRKRFHKNQLLH 622
           Y+ H  K  R ++  I + +NLR  F  N+LLH
Sbjct: 14  YLRHNSKVNRGNRSFIPISLNLRSHFTSNKLLH 46


>At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746590
          Length = 682

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 5/79 (6%)
 Frame = +3

Query: 39  EIH*ILDKNFKMNLTTEIQAD-----VNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQ 203
           E+H   DK  K  + T+  AD     +   + +Y EKI   +A+           A +  
Sbjct: 569 ELHAQKDKERKELIDTKNTADTTIYSIEKSLGEYREKIPSEIAKEIEDAVADLRSASSGD 628

Query: 204 TLLDIIAKFNQGNKAKAKV 260
            L +I AK    NKA +K+
Sbjct: 629 DLNEIKAKIEAANKAVSKI 647


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,184,964
Number of Sequences: 28952
Number of extensions: 180224
Number of successful extensions: 540
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 531
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 540
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1422784080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -