SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ...    30   1.9  
At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ...    30   1.9  
At2g32910.1 68415.m04035 expressed protein                             29   3.4  
At5g45220.1 68418.m05550 Toll-Interleukin-Resistance (TIR) domai...    29   4.5  
At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type pept...    29   4.5  

>At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative
           (UBP27) similar to GI:11993494; ubiquitin specific
           protease 66 - Gallus gallus,PID:g3800764
          Length = 361

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +2

Query: 302 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 424
           R ++ + T+Y + FNL S   A + + HLI + +E + V+C
Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186


>At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative
           (UBP27) similar to GI:11993494; ubiquitin specific
           protease 66 - Gallus gallus,PID:g3800764
          Length = 494

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +2

Query: 302 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 424
           R ++ + T+Y + FNL S   A + + HLI + +E + V+C
Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186


>At2g32910.1 68415.m04035 expressed protein 
          Length = 691

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = +3

Query: 144 DAYHDDGWFICNSHLIKRFKMSKMVLPIFDEDD 242
           D+Y  D ++IC  H ++R   + MV P   +DD
Sbjct: 610 DSYRRDPYYICERHALERPPRTYMVSPGRQDDD 642


>At5g45220.1 68418.m05550 Toll-Interleukin-Resistance (TIR)
           domain-containing protein domain signature TIR exists,
           suggestive of a disease resistance protein.
          Length = 546

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +3

Query: 603 GDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCI--IDETGLVASV 755
           GDQL NN+ G+L + +RR+    +  ID +E R  +  T    I+++G+   V
Sbjct: 339 GDQLRNNFVGYLVDALRRSEINVF--IDNQEQRGEDLNTLFKRIEDSGIAIVV 389


>At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type
           peptidyl-prolyl cis-trans isomerase, putative contains
           Pfam profile: PF00254, FKBP-type peptidyl-prolyl
           cis-trans isomerases
          Length = 694

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 121 HTSHRVRPTRIMTTDGLSATATSSNVLKCQKWF-CPFSTKTTINSNDDR 264
           H+S    P+R+  +    +T  S    KC+K F    +T  T+++ +D+
Sbjct: 415 HSSESPLPSRVTRSKARKSTLESGEPAKCEKTFEAKINTHKTLDNREDK 463


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,649,302
Number of Sequences: 28952
Number of extensions: 330987
Number of successful extensions: 739
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 728
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 739
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1702303248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -