SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120036.Seq
         (735 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g39520.1 68417.m05588 GTP-binding protein, putative similar t...    29   3.2  
At1g14030.1 68414.m01658 ribulose-1,5 bisphosphate carboxylase o...    28   5.6  
At1g51450.1 68414.m05791 SPla/RYanodine receptor (SPRY) domain-c...    27   9.8  

>At4g39520.1 68417.m05588 GTP-binding protein, putative similar to
           SP|Q9Y295 Developmentally regulated GTP-binding protein
           1 (DRG 1) {Homo sapiens}; contains Pfam profiles
           PF02824: TGS domain, PF01018: GTP1/OBG family
          Length = 369

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +1

Query: 487 NDLSPLQLGNVLYEPCTYDMQKLGSFILVSLSARDKL 597
           +DL  +  G+ +Y PC Y + K+ S  L  L   DKL
Sbjct: 229 DDLIDVIEGSRIYMPCIYAVNKIDSITLEELEILDKL 265


>At1g14030.1 68414.m01658 ribulose-1,5 bisphosphate carboxylase
           oxygenase large subunit N-methyltransferase, putative
           strong similarity to SP|P94026 Ribulose-1,5 bisphosphate
           carboxylase/oxygenase large subunit N-
           methyltransferase, chloroplast precursor (EC 2.1.1.127)
           ([Ribulose- bisphosphate-carboxylase]-lysine
           N-methyltransferase) {Nicotiana tabacum}; contains Pfam
           profile PF00856: SET domain; Rare GC intron splice site
           at 49572 is inferred from protein alignment and is not
           confirmed experimentally
          Length = 482

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +1

Query: 244 YRMCRSIPESEDKIGDKLDLKKSTK 318
           Y +   IPES+   GDKLD+ +S K
Sbjct: 306 YTLTIEIPESDPFFGDKLDIAESNK 330


>At1g51450.1 68414.m05791 SPla/RYanodine receptor (SPRY)
           domain-containing protein low similarity to DEAD box
           protein DDX1 [Gallus gallus] GI:16323037,  ryanodine
           receptor [Caenorhabditis elegans] GI:1871447; contains
           Pfam profile PF00622: SPRY domain
          Length = 509

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +1

Query: 487 NDLSPLQLGNVLYEPCTYDMQKL 555
           NDL+PL+   ++ EP   D++KL
Sbjct: 86  NDLAPLESSGIIEEPIDTDLEKL 108


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,626,903
Number of Sequences: 28952
Number of extensions: 283162
Number of successful extensions: 617
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 605
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 617
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1614253080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -