SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g05130.1 68418.m00544 SNF2 domain-containing protein / helica...    33   0.20 
At2g03140.1 68415.m00267 CAAX amino terminal protease family pro...    29   3.3  
At3g12420.1 68416.m01547 hypothetical protein                          29   4.4  
At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50...    29   4.4  
At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR...    29   4.4  
At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam ...    29   4.4  
At3g25510.1 68416.m03172 disease resistance protein (TIR-NBS-LRR...    28   5.8  
At2g28960.1 68415.m03523 leucine-rich repeat protein kinase, put...    28   5.8  
At1g63440.1 68414.m07174 copper-exporting ATPase, putative / res...    28   5.8  
At1g62540.1 68414.m07056 flavin-containing monooxygenase family ...    28   5.8  

>At5g05130.1 68418.m00544 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to transcription
           factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 862

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 16/58 (27%), Positives = 37/58 (63%)
 Frame = +3

Query: 171 PTPDGADTVVSDSETAAASNFLASVNSLLMITI*WNVCSRPLIISEKQLVLLIIRNPL 344
           P PD ++T   D++++  S+ ++++ SLLM +   N  ++ ++ S+ + +LL++  PL
Sbjct: 669 PPPDSSNTDGEDAKSSTKSSKVSALLSLLMASRQENPNTKSVVFSQFRKMLLLLETPL 726


>At2g03140.1 68415.m00267 CAAX amino terminal protease family protein
            very low similarity to SP|Q40863 Late embryogenesis
            abundant protein EMB8 from Picea glauca; contains Pfam
            profile PF02517 CAAX amino terminal protease family
            protein
          Length = 1805

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 6/75 (8%)
 Frame = +3

Query: 6    IGGDTIVNNQTTMTQINFNASY-----TSAPTPSRASFDNGYSEFCDK-QQPNDYLNYYN 167
            IG + + NN   + Q +  A++     TS      A   N  S   D  ++ +D  N   
Sbjct: 779  IGAEAVTNNDDKVEQGSGVATHQGQVETSKNDEKGAPIANEKSSVADGFEKASDAKNDST 838

Query: 168  NPTPDGADTVVSDSE 212
            NP P GAD + SD +
Sbjct: 839  NPQPVGADDITSDGD 853


>At3g12420.1 68416.m01547 hypothetical protein
          Length = 308

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 651 RFDDNDYNSNRFSDHMSETGYY 716
           R+D ND   NR+ DH +E GYY
Sbjct: 117 RYDANDLPPNRYYDHQTE-GYY 137


>At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50)
           identical to DNA repair-recombination protein GI:7110148
           from [Arabidopsis thaliana]
          Length = 1316

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -3

Query: 186 LHPAWDCYNNSNSRW 142
           L  AWDCY ++N RW
Sbjct: 423 LSTAWDCYMDANDRW 437


>At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1036

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = +2

Query: 236 GKRQFVTDDNDIMECLLKTTDNLGEAVSSAYYSE-SLELPVAE 361
           GKRQF+ D  DI E L   T +        Y SE S EL ++E
Sbjct: 533 GKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISE 575


>At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam
           profiles PF04677: Protein similar to CwfJ N terminus 1,
           PF04676: Protein similar to CwfJ N terminus 2
          Length = 692

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = -3

Query: 282 KHSIISLSSVTN*RLPKSLKLLQSRCQILP 193
           KH ++S+++ T   LP+   L+Q  C ILP
Sbjct: 481 KHLVVSIANFTYLMLPQHQPLVQGHCCILP 510


>At3g25510.1 68416.m03172 disease resistance protein (TIR-NBS-LRR
            class), putative domain signature TIR-NBS-LRR exists,
            suggestive of a disease resistance protein.
          Length = 1981

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 17/38 (44%), Positives = 19/38 (50%)
 Frame = +2

Query: 236  GKRQFVTDDNDIMECLLKTTDNLGEAVSSAYYSESLEL 349
            GKRQF+ D  DI E L   TD+ G       Y  S EL
Sbjct: 1747 GKRQFLVDARDICEVL---TDDTGSKSVVGIYFNSAEL 1781


>At2g28960.1 68415.m03523 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 880

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 5/55 (9%)
 Frame = +3

Query: 201 SDSETAAASNFLASVNSLLMITI*WNVCSRPL--IISEKQ---LVLLIIRNPLSC 350
           ++S T     FLAS+ SL +I + WN  + PL  ++ +++   L L I  NP  C
Sbjct: 441 NNSFTGGVPEFLASMKSLSIINLNWNDLTGPLPKLLLDREKNGLKLTIQGNPKLC 495


>At1g63440.1 68414.m07174 copper-exporting ATPase, putative /
           responsive-to-antagonist 1, putative /
           copper-transporting ATPase, putative similar to ATP
           dependent copper transporter SP|Q9S7J8 [Arabidopsis
           thaliana]
          Length = 995

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +3

Query: 177 PDGADTVVSDSETAAASNFLASVNSLLM 260
           PD A+ +++DSE  A +  L S+NS L+
Sbjct: 761 PDDAEELLADSEDMAQTGILVSINSELI 788


>At1g62540.1 68414.m07056 flavin-containing monooxygenase family
           protein / FMO family protein similar to
           flavin-containing monooxygenase GB:AAA21178 GI:349534
           from Oryctolagus cuniculus [SP|P32417], SP|P97501 from
           Mus musculus; contains Pfam profile PF00743
           Flavin-binding monooxygenase-like
          Length = 457

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +3

Query: 630 DFAPYLMRFDDNDYNSNRFSDHMSETGY 713
           DF P++ RFDD   +S R+  HM    Y
Sbjct: 90  DF-PFVPRFDDESRDSRRYPSHMEVLAY 116


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,285,776
Number of Sequences: 28952
Number of extensions: 315684
Number of successful extensions: 945
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 912
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 945
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1663169840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -