SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-contain...    29   3.0  
At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-contain...    29   3.0  
At2g02790.1 68415.m00222 calmodulin-binding family protein very ...    28   4.0  
At5g08780.1 68418.m01041 histone H1/H5 family protein contains P...    28   5.2  
At4g25320.1 68417.m03643 DNA-binding protein-related contains Pf...    28   5.2  
At1g77060.1 68414.m08972 mutase family protein similar to carbox...    28   5.2  
At1g70420.1 68414.m08102 expressed protein                             28   5.2  

>At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-containing
           protein / RhoGAP domain-containing protein weak
           similarity to rho-GTPase activating protein [Homo
           sapiens] GI:14245732; contains Pfam profiles PF00169: PH
           domain, PF00620: RhoGAP domain
          Length = 870

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = +3

Query: 57  QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 197
           Q   G F    DT   +Y+       RF+ +D  S+L YVN ER  R
Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735


>At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-containing
           protein / RhoGAP domain-containing protein weak
           similarity to rho-GTPase activating protein [Homo
           sapiens] GI:14245732; contains Pfam profiles PF00169: PH
           domain, PF00620: RhoGAP domain
          Length = 822

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = +3

Query: 57  QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 197
           Q   G F    DT   +Y+       RF+ +D  S+L YVN ER  R
Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735


>At2g02790.1 68415.m00222 calmodulin-binding family protein very low
           similarity to SP|P12036 Neurofilament triplet H protein
           {Homo sapiens}; contains Pfam profile PF00612: IQ
           calmodulin-binding motif
          Length = 636

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
 Frame = +1

Query: 184 NGQYVSTSTASTNRRLSMPTKSSTCSR*RG--KAGR--PAVFAPTHSAHYQI 327
           NG   S +T  ++RR S+P K     +  G  ++GR  P+  APT SA  +I
Sbjct: 472 NGNVASENTKPSDRRASLPAKIENHHQDDGLTQSGRKIPSYMAPTASAKARI 523


>At5g08780.1 68418.m01041 histone H1/H5 family protein contains Pfam
           domain, PF00538: linker histone H1 and H5 family
          Length = 457

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%)
 Frame = +3

Query: 183 ERAIRVHVDGKYKST-FEHADQIQHMLQIAWQSRATRCICTHTQCSLP 323
           E AI   +  KYK+  F H + + H L    + R   C C +   SLP
Sbjct: 77  EDAISEFIKSKYKNLPFAHTNLLSHHLAKLVEKREILCDCNNDCYSLP 124


>At4g25320.1 68417.m03643 DNA-binding protein-related contains Pfam
           domain PF03479: Domain of unknown function (DUF296),
           found in AT-hook motifs Pfam:PF02178
          Length = 404

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +1

Query: 202 TSTASTNRRLSMPTKSSTCSR*RGKAGRPAVFAP 303
           T  A+T   L+MPT++++  + + K GRP  + P
Sbjct: 64  TENAATPFSLTMPTENTSAEQLKKKRGRPRKYNP 97


>At1g77060.1 68414.m08972 mutase family protein similar to
           carboxyvinyl-carboxyphosphonate phosphorylmutase
           GB:O49290 from [Arabidopsis thaliana]; similar to
           carboxyphosphonoenolpyruvate mutase (GI:47149)
           [Streptomyces hygroscopicus]; contains Prosite PS00161:
           Isocitrate lyase signature
          Length = 339

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = +2

Query: 248 PAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKS 355
           P H PD + + G  L +HP T L   +  +  ++K+
Sbjct: 256 PLHTPDELKEMGFHLIVHPLTALYASTRALVDVLKT 291


>At1g70420.1 68414.m08102 expressed protein
          Length = 272

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = +1

Query: 184 NGQYVSTSTASTNRRLSMPTKSSTCSR*RGKAGRPAVFAPTHSAHYQIW 330
           NG   ++ST+ST  RLS   KSS   + + K  +      T SAH +++
Sbjct: 187 NGSSSTSSTSSTAARLSGVVKSSEKGKEKTKTDKKKDKMRTKSAHEKLY 235


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,391,284
Number of Sequences: 28952
Number of extensions: 295902
Number of successful extensions: 779
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 758
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 779
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1141585696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -