SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g65710.1 68414.m07458 expressed protein ; expression supporte...    34   0.082
At1g68490.1 68414.m07824 expressed protein                             32   0.33 
At3g63100.1 68416.m07087 glycine-rich protein                          31   0.76 
At4g02070.1 68417.m00277 DNA mismatch repair protein MSH6-1 (MSH...    29   2.3  
At1g57570.1 68414.m06533 jacalin lectin family protein similar t...    28   5.4  
At1g01660.1 68414.m00084 U-box domain-containing protein               28   5.4  
At4g19940.1 68417.m02921 F-box family protein contains Pfam PF00...    27   9.4  
At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa...    27   9.4  
At2g01760.1 68415.m00106 two-component responsive regulator fami...    27   9.4  

>At1g65710.1 68414.m07458 expressed protein ; expression supported
           by MPSS
          Length = 455

 Score = 34.3 bits (75), Expect = 0.082
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +3

Query: 201 RARKIVLSALVAQRSSRGRKTILNADDVYECVLIKPIRTEHFRSVDEA 344
           +A ++VLS   + R SR    + N D+ Y  +L+K I++ H +SVD++
Sbjct: 332 KAPQVVLSRSRSLRKSRDFDLVSNEDNNYTALLLKDIQSFHGKSVDDS 379


>At1g68490.1 68414.m07824 expressed protein
          Length = 183

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 15/35 (42%), Positives = 21/35 (60%)
 Frame = -3

Query: 313 RIGLINTHSYTSSALRIVFLPRLDRCATSADNTIL 209
           RIGL N H + S +LR  F  +L+ C + A+  IL
Sbjct: 39  RIGLRNNHHHPSRSLRCYFSHQLELCESKAETDIL 73


>At3g63100.1 68416.m07087 glycine-rich protein 
          Length = 199

 Score = 31.1 bits (67), Expect = 0.76
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +2

Query: 332 RRRGWRTQHGRFKDHHRYGHQVHWQTGRRR 421
           RR G   +HGR + HHR GH  H   G RR
Sbjct: 107 RRHGRDHRHGRDRGHHR-GHGHHHHRGHRR 135


>At4g02070.1 68417.m00277 DNA mismatch repair protein MSH6-1
           (MSH6-1) (AGAA.3) identical to SP|O04716 DNA mismatch
           repair protein MSH6-1 (AtMsh6-1) cress] {Arabidopsis
           thaliana}
          Length = 1324

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 1/120 (0%)
 Frame = +3

Query: 183 KQRVFKRARKIVLSALVAQRSSRGRKTILNADDVYECVLIKPIRTEHFRSV-DEAGEHNM 359
           K +V KR    V + +     + G   + N D  Y   L     TE   S+ +   EHN 
Sbjct: 475 KDKVVKRE---VCAVVTKGTLTDGEMLLTNPDASYLMAL-----TEGGESLTNPTAEHNF 526

Query: 360 GVLKIIIDTVIKYIGKLADDEYILIADRMYVDLIYSEFRAIILPQSAYIIKEITQKAIVK 539
           GV  + + T    +G+  DD+     D   +  + SE R + + + A ++   T++ IV+
Sbjct: 527 GVCLVDVATQKIILGQFKDDQ-----DCSALSCLLSEMRPVEIIKPAKVLSYATERTIVR 581


>At1g57570.1 68414.m06533 jacalin lectin family protein similar to
           myrosinase-binding protein homolog [Arabidopsis
           thaliana] GI:2997767; contains Pfam profile PF01419
           jacalin-like lectin domain
          Length = 614

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 13/46 (28%), Positives = 22/46 (47%)
 Frame = +1

Query: 85  WIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYY 222
           WIHPR+   K ++  N + D  N + +  + V   V   ++ K  Y
Sbjct: 169 WIHPRKMEAKGSKGGNQWDDGTNNDGVTKIHVRGGVEGIQYIKFDY 214


>At1g01660.1 68414.m00084 U-box domain-containing protein
          Length = 568

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 15/64 (23%), Positives = 28/64 (43%)
 Frame = +2

Query: 359 GRFKDHHRYGHQVHWQTGRRRVHFDSGPHVCRFNLFRI*GHYFASERVHYKGDYAESDSE 538
           G   DHH        ++ + +  +   P  C   +F   GH   ++  + +    E++SE
Sbjct: 114 GAASDHHYSEKMFDLKSRKAKYVYQHAPSSCEV-MFMCDGHLIYTKEANLEDCMGETESE 172

Query: 539 SGQS 550
           +GQS
Sbjct: 173 AGQS 176


>At4g19940.1 68417.m02921 F-box family protein contains Pfam
           PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box
           protein interaction domain;similar to F-box protein Fbx8
           (GI:6164735) [Homo
           sapiens]|8737673|gb|AV566223.1|AV566223
          Length = 411

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = -3

Query: 304 LINTHSYTSSALRIVFLPRLDRCATSADNTILRARL 197
           LI + ++T+  L++   PRL  C +S+DN+ L+  L
Sbjct: 65  LICSRNFTNRLLKLSSPPRLFMCLSSSDNSHLKTVL 100


>At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch
           domain-containing protein / RNA recognition motif
           (RRM)-containing protein KIAA0122 gene , Homo sapiens,
           EMBL:HSDKG02; contains Pfam profiles  PF00076: RNA
           recognition motif. (a.k.a. RRM, RBD, or RNP domain),
           PF01585: G-patch domain, weak hit to PF00641: Zn-finger
           in Ran binding protein and others
          Length = 1105

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/57 (24%), Positives = 24/57 (42%)
 Frame = +2

Query: 479 HYFASERVHYKGDYAESDSESGQSVDVCNELKYPWNLITANSFIVSTDESRQSQYIY 649
           +Y  SE     G Y + + E     D C++     N   + ++  S D+ R+  Y Y
Sbjct: 120 YYHDSEAGSRNGHYRDHEHERSSRYDGCDDYSCNDNNYRSKNYHHSRDDGREKDYDY 176


>At2g01760.1 68415.m00106 two-component responsive regulator family
           protein / response regulator family protein similar to
           response regulator 9 (GI:14189890) [Zea mays]; similar
           to ARR1 protein (GI:4210449) [Arabidopsis thaliana];
           contains Pfam profile: PF00072 response regulator
           receiver domain
          Length = 382

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = +1

Query: 52  KPMRPPKPMQCWIHPRRANCKVTRP-RNNYSDPDNENDMLHMTVLNSV 192
           KP+RP +    W H  R  C + +  R++ +  DN+N     TV+ SV
Sbjct: 113 KPIRPEELKNIWQHVVRRKCVMKKELRSSQALEDNKNSGSLETVVVSV 160


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,633,385
Number of Sequences: 28952
Number of extensions: 260599
Number of successful extensions: 723
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 710
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 723
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1555552968
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -