SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g41280.1 68418.m05017 hypothetical protein contains Pfam prof...    30   1.8  
At3g59240.1 68416.m06604 F-box family protein contains F-box dom...    29   4.1  
At1g07900.1 68414.m00859 LOB domain protein 1 / lateral organ bo...    28   5.5  
At2g21370.2 68415.m02542 xylulose kinase, putative similar to xy...    28   7.2  
At2g21370.1 68415.m02543 xylulose kinase, putative similar to xy...    28   7.2  
At5g07380.1 68418.m00845 hypothetical protein                          27   9.6  
At4g05150.1 68417.m00773 octicosapeptide/Phox/Bem1p (PB1) domain...    27   9.6  
At3g14360.1 68416.m01817 lipase class 3 family protein low simil...    27   9.6  

>At5g41280.1 68418.m05017 hypothetical protein contains Pfam
           profile: PF01657 domain of unknown function
          Length = 286

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +2

Query: 302 LYHFACLMKYKD---IQKYEVQQLIEWAINASPDMDLQQFRIEFMDKTTELNLRSCQPKS 472
           +Y+F+C+++Y D   +   E +    W+ +        +F     DK  E+ +RS    S
Sbjct: 117 IYYFSCMVRYSDKFFLSTLETKPNTYWSSDDPIPKSYDKFGQRLSDKMGEVIIRSSLLSS 176

Query: 473 FTYTFTTIWDTMTF 514
            ++T   + DT TF
Sbjct: 177 -SFTPYYLMDTTTF 189


>At3g59240.1 68416.m06604 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 504

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 245 FASSKSAHLTKLLSSQATYLYHFACLMKYKD 337
           F  +K A LT LLS +  YL+ FA ++ + D
Sbjct: 24  FVPTKEAALTSLLSEKWRYLFAFAPILDFDD 54


>At1g07900.1 68414.m00859 LOB domain protein 1 / lateral organ
           boundaries domain protein 1 (LBD1) identical to
           SP|Q9LQR0 LOB domain protein 1 {Arabidopsis thaliana}
          Length = 190

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%)
 Frame = -1

Query: 234 DETNTTNSCLCNEKKAASAVSWRLAKRSCCIC--VRRRPQRRCTLAPTRTPT 85
           D +  T   + +      ++S R+    C  C  +RRR   RC LAP   PT
Sbjct: 6   DASVATTPIISSSSSPPPSLSPRVVLSPCAACKILRRRCAERCVLAPYFPPT 57


>At2g21370.2 68415.m02542 xylulose kinase, putative similar to
           xylulose kinase (Xylulokinase) [Bacillus subtilis]
           Swiss-Prot:P39211
          Length = 385

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +3

Query: 531 RYGVYARQKQSRFCHAAVENDEGAILQRIF 620
           RYGVY+ +   ++      N  GAIL+++F
Sbjct: 223 RYGVYSHRLDDKWLVGGASNTGGAILRQLF 252


>At2g21370.1 68415.m02543 xylulose kinase, putative similar to
           xylulose kinase (Xylulokinase) [Bacillus subtilis]
           Swiss-Prot:P39211
          Length = 478

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +3

Query: 531 RYGVYARQKQSRFCHAAVENDEGAILQRIF 620
           RYGVY+ +   ++      N  GAIL+++F
Sbjct: 316 RYGVYSHRLDDKWLVGGASNTGGAILRQLF 345


>At5g07380.1 68418.m00845 hypothetical protein 
          Length = 595

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = +1

Query: 391 RHGLATV-SHRIYGQNHRTQFAFVPAQEFYLHVYHH 495
           R GL  +   RI G + + +FA+ P   F L  +HH
Sbjct: 44  RIGLCYILKDRISGNDQQLKFAYTPTGNFCLRDFHH 79


>At4g05150.1 68417.m00773 octicosapeptide/Phox/Bem1p (PB1)
           domain-containing protein various predicted proteins
           contains Pfam profile PF00564: PB1 domain
          Length = 477

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
 Frame = +1

Query: 394 HGLATVSHRIYGQNHRTQFAFVPAQEFYLHVYHH--MGHH 507
           H +   +H +   NH  Q   +P Q  YL  YHH  MG+H
Sbjct: 366 HMVQQGNHMVQPGNHMVQPVQMPGQ--YLQQYHHVPMGYH 403


>At3g14360.1 68416.m01817 lipase class 3 family protein low
           similarity to Chain A, Lipase Ii From Rhizopus Niveus
           GI:1942798; contains Pfam profile PF01764: Lipase
          Length = 518

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 481 VSKTLGLARTQIEFCGFVHKFYAKLLQVHVG 389
           V K + L RT +EF GFV  F+  L   + G
Sbjct: 78  VRKIIRLLRTPMEFTGFVVDFFLNLFSANGG 108


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,500,222
Number of Sequences: 28952
Number of extensions: 317770
Number of successful extensions: 896
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 874
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 895
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1584903024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -