SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g02730.1 68414.m00226 cellulose synthase family protein simil...    32   0.33 
At2g27170.1 68415.m06029 structural maintenance of chromosomes (...    29   4.1  
At5g38350.1 68418.m04628 disease resistance protein (NBS-LRR cla...    28   5.4  
At2g22610.1 68415.m02680 kinesin motor protein-related                 27   9.5  

>At1g02730.1 68414.m00226 cellulose synthase family protein similar to
            cellulose synthase catalytic subunit [gi:13925881] from
            Nicotiana alata, cellulose synthase-4 [gi:9622880] from
            Zea mays
          Length = 1181

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -2

Query: 414  GREQCAQRVEIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVDFAFVSL 235
            G ++ A    + + FL+V    + MVN+IA+ + +   +   F  ++K+   V F+F  L
Sbjct: 1068 GDDEFADLYVVKWSFLMVPPLTIMMVNMIAIAVGLARTLYSPFPQWSKLVGGVFFSFWVL 1127

Query: 234  CTYLY 220
            C +LY
Sbjct: 1128 C-HLY 1131


>At2g27170.1 68415.m06029 structural maintenance of chromosomes
           (SMC) family protein similar to basement
           membrane-associated chondroitin proteoglycan Bamacan
           [Rattus norvegicus] GI:1785540; contains Pfam profile
           PF02463: RecF/RecN/SMC N terminal domain. No suitalble
           start codon was identified.
          Length = 1207

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/70 (22%), Positives = 29/70 (41%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           L ++ E + KH  ++     +   +HE F      R E+   R  +   +  +    +KL
Sbjct: 427 LTERDEHIKKHEVEIGELESRISKSHELFNTKKRERDEEQRKRKEKWGEESQLSSEIDKL 486

Query: 687 KTAIVTESKN 716
           KT +    KN
Sbjct: 487 KTELERAKKN 496


>At5g38350.1 68418.m04628 disease resistance protein (NBS-LRR
           class), putative domain signature NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 833

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 13/50 (26%), Positives = 29/50 (58%)
 Frame = -2

Query: 552 SVFLHVLKQIQFCRAIITLAFSLKVQQRVAFVVKI*PHQNFQQPLLGREQ 403
           S+F+  +K++ + R + +  +S K+Q +  F+ +I  H++ +   LG  Q
Sbjct: 77  SIFMGNIKELMYTRPVCSDEYSAKIQLQKQFLSQIINHKDMELHHLGVAQ 126


>At2g22610.1 68415.m02680 kinesin motor protein-related 
          Length = 1093

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 15/62 (24%), Positives = 34/62 (54%)
 Frame = +3

Query: 507  LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
            L  +++   KH++++ T  E   V + T  N+V   F++       +++  N+L+++ +L
Sbjct: 940  LEMRLKEQEKHIQEMATTREFPEVANAT-PNEVKTCFKEDNFGNENMESNTNILRTSNRL 998

Query: 687  KT 692
            KT
Sbjct: 999  KT 1000


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,057,234
Number of Sequences: 28952
Number of extensions: 239359
Number of successful extensions: 748
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 748
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -