SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g25300.1 68418.m03001 F-box family protein PF0064: F-box doma...    32   0.49 
At3g02600.1 68416.m00251 phosphatidic acid phosphatase family pr...    29   4.5  
At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50...    29   4.5  
At3g03970.3 68416.m00418 expressed protein                             28   7.9  
At3g03970.2 68416.m00417 expressed protein                             28   7.9  
At3g03970.1 68416.m00416 expressed protein                             28   7.9  
At2g38720.1 68415.m04755 microtubule associated protein (MAP65/A...    28   7.9  
At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN ...    28   7.9  

>At5g25300.1 68418.m03001 F-box family protein PF0064: F-box domain;
           similar to F-box protein family, AtFBX7 (GI:20197899)
           [Arabidopsis thaliana]
          Length = 464

 Score = 31.9 bits (69), Expect = 0.49
 Identities = 15/37 (40%), Positives = 19/37 (51%)
 Frame = -3

Query: 280 IVVWLFTIVRRQCQLAKKCRAHHKDIDIFKHLCPELQ 170
           IVVW F          K    H++DI I K++C ELQ
Sbjct: 104 IVVWFFDKGTEYIAFCKNGEDHYRDIPIRKNVCKELQ 140


>At3g02600.1 68416.m00251 phosphatidic acid phosphatase family
           protein / PAP2 family protein similar to phosphatidic
           acid phosphatase [Mus musculus] GI:1487873; contains
           Pfam profile: PF01569 phosphatase PAP2 superfamily
          Length = 364

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 6/54 (11%)
 Frame = +1

Query: 43  RLGLGQLQAYRVRSHGQRVCGSHV*K------LVIMKSGFLVAQHYYRFAVRDI 186
           R+   QL  + +RSHG  V  +H+        LVI++   L+   +YRF  +D+
Sbjct: 50  RMREAQLGGHTLRSHGMTVARTHMHDWIILVLLVILECVLLIIHPFYRFVGKDM 103


>At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50)
           identical to DNA repair-recombination protein GI:7110148
           from [Arabidopsis thaliana]
          Length = 1316

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -1

Query: 423 LHPAWDCYNNSNSRW 379
           L  AWDCY ++N RW
Sbjct: 423 LSTAWDCYMDANDRW 437


>At3g03970.3 68416.m00418 expressed protein
          Length = 554

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 23/107 (21%), Positives = 42/107 (39%), Gaps = 4/107 (3%)
 Frame = +3

Query: 294 FNASYTSAPTPSRASFDNGYS----EFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAA 461
           FN S  S    SR+S  N       + C K   + +         D    ++  SET+++
Sbjct: 410 FNESVCSRTNRSRSSRRNTKKRQSGDICSKHHRHGFAQDPFTELLDNRQQLLQYSETSSS 469

Query: 462 SNFLASVNSLTDDNDIWNVCSRPLIISEKQLVLLIIRNPLSCLLRRT 602
           S+   +  + T  N   ++C +P    + +  L  +   L   L R+
Sbjct: 470 SSIYDTSGTTTPTNTTEDICEKPKTDLDSEAKLKTVETELDPRLGRS 516


>At3g03970.2 68416.m00417 expressed protein
          Length = 554

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 23/107 (21%), Positives = 42/107 (39%), Gaps = 4/107 (3%)
 Frame = +3

Query: 294 FNASYTSAPTPSRASFDNGYS----EFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAA 461
           FN S  S    SR+S  N       + C K   + +         D    ++  SET+++
Sbjct: 410 FNESVCSRTNRSRSSRRNTKKRQSGDICSKHHRHGFAQDPFTELLDNRQQLLQYSETSSS 469

Query: 462 SNFLASVNSLTDDNDIWNVCSRPLIISEKQLVLLIIRNPLSCLLRRT 602
           S+   +  + T  N   ++C +P    + +  L  +   L   L R+
Sbjct: 470 SSIYDTSGTTTPTNTTEDICEKPKTDLDSEAKLKTVETELDPRLGRS 516


>At3g03970.1 68416.m00416 expressed protein
          Length = 554

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 23/107 (21%), Positives = 42/107 (39%), Gaps = 4/107 (3%)
 Frame = +3

Query: 294 FNASYTSAPTPSRASFDNGYS----EFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAA 461
           FN S  S    SR+S  N       + C K   + +         D    ++  SET+++
Sbjct: 410 FNESVCSRTNRSRSSRRNTKKRQSGDICSKHHRHGFAQDPFTELLDNRQQLLQYSETSSS 469

Query: 462 SNFLASVNSLTDDNDIWNVCSRPLIISEKQLVLLIIRNPLSCLLRRT 602
           S+   +  + T  N   ++C +P    + +  L  +   L   L R+
Sbjct: 470 SSIYDTSGTTTPTNTTEDICEKPKTDLDSEAKLKTVETELDPRLGRS 516


>At2g38720.1 68415.m04755 microtubule associated protein
           (MAP65/ASE1) family protein low similarity to myosin
           [Schistosoma japonicum] GI:3941320; contains Pfam
           profile PF03999: Microtubule associated protein
           (MAP65/ASE1 family)
          Length = 587

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = -3

Query: 259 IVRRQCQLAKKCRAHHKDID 200
           + +RQC+L + CR +H DI+
Sbjct: 311 VFKRQCELEEICRGNHMDIN 330


>At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN
           protein (ETT) identical to ETTIN GB:AF007788 from
           [Arabidopsis thaliana]
          Length = 608

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +3

Query: 411 TPDGADTVVSDSETAAASNFLASVNSLTDDN--DIWNVCSRPLIISEKQLVLLI 566
           TP  A   VS + +++AS  + S NS       ++W+ C+ PLI   K+  L++
Sbjct: 21  TPSSASGSVSPTSSSSASVSVVSSNSAGGGVCLELWHACAGPLISLPKRGSLVL 74


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,310,601
Number of Sequences: 28952
Number of extensions: 330927
Number of successful extensions: 868
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 836
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 868
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1726528800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -