SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g36920.1 68418.m04425 expressed protein predicted protein, Ar...    30   1.8  
At5g17690.1 68418.m02073 like heterochromatin protein (LHP1) ide...    29   2.4  
At4g21660.1 68417.m03138 proline-rich spliceosome-associated (PS...    29   4.2  
At4g36010.1 68417.m05127 pathogenesis-related thaumatin family p...    28   5.5  
At2g17860.1 68415.m02069 pathogenesis-related thaumatin family p...    28   5.5  
At2g04080.1 68415.m00391 MATE efflux family protein similar to h...    28   7.3  
At5g28320.1 68418.m03438 expressed protein This is likely a pseu...    27   9.6  
At2g24810.1 68415.m02968 pathogenesis-related thaumatin family p...    27   9.6  

>At5g36920.1 68418.m04425 expressed protein predicted protein,
           Arabidopsis thaliana; expression supported by MPSS
          Length = 82

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -1

Query: 621 NSAKFALVSTAVCLFLLAGIAALSLEDDDVDRSAIFLPSFQC 496
           N++   L+S  +CL  + G+   S+ DDD+  +    PS  C
Sbjct: 5   NTSHVLLLSLLLCLMFVIGLVEASIPDDDMGPAIYTPPSGSC 46


>At5g17690.1 68418.m02073 like heterochromatin protein (LHP1)
           identical to like heterochromatin protein LHP1
           [Arabidopsis thaliana] GI:15625407; contains Pfam
           profile PF00385: 'chromo' (CHRromatin Organization
           MOdifier)
          Length = 445

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 18/62 (29%), Positives = 27/62 (43%)
 Frame = +3

Query: 405 IKQPEWPSSPAMWDLVKNTPELADFVFIFDHTEKMVKKWPTDRHRRLQATTQQFQRAKKD 584
           IK   WP +   W+ ++N   +AD   + D  E  +K     R R+ +      Q  KK 
Sbjct: 127 IKWRGWPETANTWEPLENLQSIAD---VIDAFEGSLKPGKPGRKRKRKYAGPHSQMKKKQ 183

Query: 585 RL 590
           RL
Sbjct: 184 RL 185


>At4g21660.1 68417.m03138 proline-rich spliceosome-associated (PSP)
           family protein similar to SP|Q13435 Splicing factor 3B
           subunit 2 (Spliceosome associated protein 145) (SAP 145)
           (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa
           subunit) {Homo sapiens}; contains Pfam profiles PF04046:
           PSP, PF04037: Domain of unknown function (DUF382)
          Length = 584

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 2/88 (2%)
 Frame = +3

Query: 276 EKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSW-YTKIKQPEW-PSSPAMWDL 449
           EK+++   +N      D+ + ++ K+K I+N K  L       ++KQ    P    +WD 
Sbjct: 124 EKEDVKKKVNSDSDSDDDEQDNQNKEKGISNKKKKLQRRMKIAELKQVSARPDVVEVWDA 183

Query: 450 VKNTPELADFVFIFDHTEKMVKKWPTDR 533
               P+L  F+  + +T  + + W   R
Sbjct: 184 TSADPKLLVFLKSYRNTVPVPRHWSQKR 211


>At4g36010.1 68417.m05127 pathogenesis-related thaumatin family
           protein similar to receptor serine/threonine kinase PR5K
           [Arabidopsis thaliana] GI:1235680; contains Pfam profile
           PF00314: Thaumatin family
          Length = 301

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = -2

Query: 167 EDCCSGMFTMFDFCKPLKRPACILDDIFF*CPTAWQFVCDEDT 39
           E CCSG F   D CKP +      +     CP A+ +  D+ T
Sbjct: 196 EYCCSGAFGTPDTCKPSEYSQFFKNA----CPRAYSYAYDDGT 234


>At2g17860.1 68415.m02069 pathogenesis-related thaumatin family
           protein similar to receptor serine/threonine kinase PR5K
           [Arabidopsis thaliana] GI:1235680; contains Pfam profile
           PF00314: Thaumatin family
          Length = 253

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)
 Frame = -2

Query: 167 EDCCSGMFTMFDFCKPLKRPACILDDIFF--*CPTAWQFVCDEDT 39
           E CC+G F   D C+P +        +FF   CPTA+ +  D+ T
Sbjct: 195 EFCCNGAFGTPDTCQPSEY------SVFFKKTCPTAYSYAYDDGT 233


>At2g04080.1 68415.m00391 MATE efflux family protein similar to
           hypothetical protein GB:AAC27412; contains Pfam profile
           PF01554: Uncharacterized membrane protein family
          Length = 476

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +1

Query: 364 TTINTFCLTVGTLRSSSPSGLVA 432
           T++ + CLT+GTL    PSG+ A
Sbjct: 287 TSVLSICLTIGTLHYVIPSGVAA 309


>At5g28320.1 68418.m03438 expressed protein This is likely a
           pseudogene.
          Length = 967

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
 Frame = +3

Query: 417 EWPSSPAMWDLV--KNTPELADFVFIFDHTEKMVKKW 521
           EW     + D+V      ELAD V ++D  EK++ +W
Sbjct: 601 EWMKDEKLRDIVFCVRDNELADGVSVYDPLEKIIPRW 637


>At2g24810.1 68415.m02968 pathogenesis-related thaumatin family
           protein similar to thaumatin-like protein [Arabidopsis
           thaliana] GI:2435406; contains Pfam profile PF00314:
           Thaumatin family
          Length = 193

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 14/40 (35%), Positives = 19/40 (47%)
 Frame = -2

Query: 167 EDCCSGMFTMFDFCKPLKRPACILDDIFF*CPTAWQFVCD 48
           E CC+G F+  + C P K            CPTA+ +V D
Sbjct: 139 EYCCTGAFSKPETCPPTKYSKIFKGA----CPTAYSYVYD 174


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,992,071
Number of Sequences: 28952
Number of extensions: 344110
Number of successful extensions: 910
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 890
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 910
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1594686376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -