SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g41530.1 68415.m05132 esterase, putative similar to SP|P10768...    98   6e-21
At5g23575.1 68418.m02766 transmembrane protein, putative similar...    29   3.4  
At1g48390.1 68414.m05405 syntaxin-related family protein contain...    28   7.9  

>At2g41530.1 68415.m05132 esterase, putative similar to SP|P10768
           Esterase D (EC 3.1.1.1) {Homo sapiens}; contains Pfam
           profile: PF00756 putative esterase
          Length = 284

 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 44/82 (53%), Positives = 60/82 (73%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+++NFI KSG QR A+ HG+ +V PDTSPRG+ ++G+  S+DFGV AGFYL+AT E W
Sbjct: 58  TCTDENFIIKSGAQRAASTHGIALVAPDTSPRGLNVEGEADSYDFGVGAGFYLNATQEKW 117

Query: 436 NNNYRMGSYLNVELYDLILKAF 501
             N+RM  Y+  EL  L+ + F
Sbjct: 118 -KNWRMYDYVVKELPKLLSENF 138



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 38/68 (55%), Positives = 48/68 (70%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL   LRN  +YKSVSAFA I NP  C WG KAF+ YLG++K+ W E+DAT L+ KYN  
Sbjct: 158 ALTIYLRNLDKYKSVSAFAPITNPINCAWGQKAFTNYLGDNKAAWEEYDATCLISKYNNL 217

Query: 741 PLTLLLDR 764
             T+L+D+
Sbjct: 218 SATILIDQ 225



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 26/48 (54%), Positives = 29/48 (60%)
 Frame = +2

Query: 110 SNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           S K+F GY K Y H S  L C M FSIY PP A     K P+LY+LSG
Sbjct: 10  STKMFDGYNKRYKHFSETLGCSMTFSIYFPPSASSSH-KSPVLYWLSG 56


>At5g23575.1 68418.m02766 transmembrane protein, putative similar to
           cleft lip and palate transmembrane protein 1 [Homo
           sapiens] GI:4039014; contains Pfam profile PF05602:
           Cleft lip and palate transmembrane protein 1 (CLPTM1)
          Length = 593

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = -1

Query: 395 TPKSHDESSPSILTPRGEVSGPTTITPCSAAYLWKPDLVM 276
           +PK  DES P +     + S P    P     LWKP++ +
Sbjct: 182 SPKDSDESEPEVEKVGDKKSDPKEEVPVEWISLWKPNVTI 221


>At1g48390.1 68414.m05405 syntaxin-related family protein contains a
           novel domain similar to F-box that is shared among other
           proteins in Arabidopsis; similar to proteins At3g54160,
           At1g47920 (syntaxin SYP81), At5g41830, At3g44180,
           At3g58890, At1g56610, At1g48390, At3g59270 [Arabidopsis
           thaliana]
          Length = 413

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = +1

Query: 364 DGDDSSWDFGVSAGFYLDATN 426
           DGD   WDF V   +Y D TN
Sbjct: 235 DGDVYGWDFNVPFDYYGDVTN 255


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,842,689
Number of Sequences: 28952
Number of extensions: 387035
Number of successful extensions: 882
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 856
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 881
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1716774400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -