SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g28250.1 68418.m03425 Ulp1 protease family protein contains P...    30   1.6  
At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family...    29   3.8  
At2g37930.1 68415.m04656 expressed protein                             27   8.8  
At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, put...    27   8.8  
At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr...    27   8.8  

>At5g28250.1 68418.m03425 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain
          Length = 939

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = -1

Query: 389 ASKRKNTTRSDDYESNKQPDYDMDL-SDFSITEVEATQYLTLL 264
           A +  N T S D ESN  P Y   L SDF++   +  Q ++ +
Sbjct: 408 ADESNNETASGDQESNPPPSYSRPLHSDFNLPSFQGDQAISTI 450


>At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family
           protein similar to SP|Q28141 ATP-dependent RNA helicase
           A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos
           taurus}; contains Pfam profiles PF00271: Helicase
           conserved C-terminal domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 1015

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +2

Query: 542 SGNACVISFSDHKLHFVSKISNKW 613
           S   C++ F D  +HF S I+N++
Sbjct: 813 SSEGCILVFDDSDMHFTSSIANRY 836


>At2g37930.1 68415.m04656 expressed protein
          Length = 467

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = -2

Query: 628 HNRFHPLVTNFTNKMEFVVTETNDTSI-PGEPILF 527
           H   HP V     +M+ V T T+D+SI   E +LF
Sbjct: 270 HKNEHPFVHTIIGEMKTVTTFTSDSSIHKSETVLF 304


>At2g28970.1 68415.m03524 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 786

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = -1

Query: 518 RGGVLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNK 339
           +G    S   P+ +++L+  F T   V  ++D CN+++ +T  ++        + Y   +
Sbjct: 197 KGNFNYSAFSPTKLELLT--FFTSGPVQCDSDGCNLQLVRTPNSTLPPLINALEAYTIIE 254

Query: 338 QPDYDMDLSDF-SITEVEATQYLT 270
            P  +  LSD  +I  ++AT  L+
Sbjct: 255 FPQLETSLSDVNAIKNIKATYRLS 278


>At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing
           protein contains Pfam profile PF01429: Methyl-CpG
           binding domain
          Length = 384

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = -1

Query: 467 SREFD---TEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNK 339
           S+E+D   TEA  N END       KT  A+ ++N T+  D +  +
Sbjct: 302 SKEYDEKTTEAEANKENDTQESDEKKTEAAANKENETQESDVKKTE 347


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,388,574
Number of Sequences: 28952
Number of extensions: 233011
Number of successful extensions: 601
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 590
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 601
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -