SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g05130.1 68418.m00544 SNF2 domain-containing protein / helica...    62   4e-10
At5g22750.1 68418.m02657 SNF2 domain-containing protein / helica...    56   3e-08
At5g43530.1 68418.m05322 SNF2 domain-containing protein / helica...    50   1e-06
At1g11100.1 68414.m01271 SNF2 domain-containing protein / helica...    50   1e-06
At3g19210.1 68416.m02438 DNA repair protein RAD54, putative simi...    49   4e-06
At1g61140.1 68414.m06888 SNF2 domain-containing protein / helica...    48   9e-06
At5g66750.1 68418.m08414 SNF2 domain-containing protein / helica...    47   1e-05
At1g05120.1 68414.m00514 SNF2 domain-containing protein / helica...    47   1e-05
At3g16600.1 68416.m02122 SNF2 domain-containing protein / helica...    46   2e-05
At2g40770.1 68415.m05030 SNF2 domain-containing protein / helica...    46   2e-05
At2g02090.1 68415.m00145 SNF2 domain-containing protein / helica...    45   7e-05
At2g44980.1 68415.m05600 transcription regulatory protein SNF2, ...    44   2e-04
At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar ...    43   2e-04
At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar ...    43   2e-04
At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil...    43   3e-04
At3g06400.1 68416.m00738 DNA-dependent ATPase, putative similar ...    43   3e-04
At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica...    43   3e-04
At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ...    42   5e-04
At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ...    42   5e-04
At1g03750.1 68414.m00355 helicase, putative similar to SP|Q03468...    42   5e-04
At3g20010.1 68416.m02531 SNF2 domain-containing protein / helica...    42   6e-04
At2g28290.2 68415.m03434 chromatin remodeling protein, putative ...    41   8e-04
At2g28290.1 68415.m03433 chromatin remodeling protein, putative ...    41   8e-04
At2g18760.1 68415.m02184 SNF2 domain-containing protein / helica...    40   0.002
At5g19310.1 68418.m02301 homeotic gene regulator, putative simil...    40   0.002
At3g06010.1 68416.m00686 homeotic gene regulator, putative simil...    40   0.002
At3g57300.1 68416.m06378 transcriptional activator, putative sim...    39   0.004
At2g44980.2 68415.m05601 transcription regulatory protein SNF2, ...    38   0.008
At4g31900.1 68417.m04533 chromatin remodeling factor, putative s...    37   0.018
At3g54280.1 68416.m05999 SNF2 domain-containing protein / helica...    37   0.018
At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding famil...    36   0.031
At3g12810.1 68416.m01598 SNF2 domain-containing protein / helica...    35   0.054
At1g02670.1 68414.m00217 DNA repair protein, putative similar to...    35   0.071
At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKL...    31   0.66 
At1g17120.1 68414.m02086 amino acid permease family protein low ...    31   0.87 
At3g54460.1 68416.m06025 SNF2 domain-containing protein / helica...    29   2.7  
At1g36675.1 68414.m04563 glycine-rich protein                          29   2.7  
At4g25120.1 68417.m03614 UvrD/REP helicase family protein contai...    28   6.1  
At1g48310.1 68414.m05396 SNF2 domain-containing protein / helica...    28   6.1  
At1g79680.1 68414.m09293 wall-associated kinase, putative simila...    28   8.1  

>At5g05130.1 68418.m00544 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to transcription
           factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 862

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 6/96 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKNNDSTNRIKS 167
           L A+ RW +TGTPI N  +D+YS++ FL+  PF+    W+ L        N    +R++ 
Sbjct: 437 LKASRRWAVTGTPIQNGSFDLYSLMAFLRFEPFSIKSYWQSLIQRPLGQGNKKGLSRLQV 496

Query: 168 IIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           ++  I L+R K +    +P  TVE  +V L  ++++
Sbjct: 497 LMATISLRRTKEKSLIGLPPKTVETCYVELSPEERQ 532



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 21/69 (30%), Positives = 31/69 (44%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K ++ SQ+ + L + E   K      L   G + V+ R      F N   T   +LL S+
Sbjct: 708 KSVVFSQFRKMLLLLETPLKAAGFTILRLDGAMTVKKRTQVIGEFGNPELTGPVVLLASL 767

Query: 724 KCGGVGLNL 750
           K  G G+NL
Sbjct: 768 KASGTGINL 776


>At5g22750.1 68418.m02657 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to SP|P36607 DNA
           repair protein rad8 {Schizosaccharomyces pombe};
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 1029

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 6/73 (8%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIK 164
           AL A  RWC+TGTPI N   D+YS++ FL+  P+     W K++ K     +      ++
Sbjct: 591 ALVADRRWCLTGTPIQNNLEDLYSLLRFLRIEPWGTWAWWNKLVQKPFEEGDERGLKLVQ 650

Query: 165 SIIKKIVLKRDKS 203
           SI+K I+L+R KS
Sbjct: 651 SILKPIMLRRTKS 663



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L +S  K IL SQW  +L + +    + N + +   G L  + R      F+   D    
Sbjct: 875  LRSSGSKSILFSQWTAFLDLLQIPLSRNNFSFVRLDGTLSQQQREKVLKEFSE--DGSIL 932

Query: 706  ILLLSIKCGGVGLNL 750
            +LL+S+K GGVG+NL
Sbjct: 933  VLLMSLKAGGVGINL 947



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = +2

Query: 236 RVCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICC 415
           RV  C  +E E+  YD L   S+  + + V   +       L     +L L+L+LRQ C 
Sbjct: 681 RVIYCELSESERDFYDALFKRSKVKFDQFVEQGKV------LHNYASILELLLRLRQCCD 734

Query: 416 HPYLAMHGRNLLETNDCFKMD--YMSSK 493
           HP+L M   +  E +D  K+   ++S K
Sbjct: 735 HPFLVMSRGDTAEYSDLNKLSKRFLSGK 762


>At5g43530.1 68418.m05322 SNF2 domain-containing protein / helicase
            domain-containing protein / RING finger domain-containing
            protein similar to SP|P36607 DNA repair protein rad8
            {Schizosaccharomyces pombe}; contains Pfam profiles
            PF00271: Helicase conserved C-terminal domain, PF00176:
            SNF2 family N-terminal domain, PF00097: Zinc finger,
            C3HC4 type (RING finger)
          Length = 1277

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 6/71 (8%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK---NND--STNRIKS 167
            L++  RWC+TGTP+ NK  D+YS++ FL   P+ +   W K++ K   N D      IK+
Sbjct: 841  LSSHCRWCLTGTPLQNKLEDLYSLLCFLHVEPWCNWAWWSKLIQKPYENGDPRGLKLIKA 900

Query: 168  IIKKIVLKRDK 200
            I++ ++L+R K
Sbjct: 901  ILRPLMLRRTK 911



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 27/78 (34%), Positives = 42/78 (53%)
 Frame = +1

Query: 535  SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
            S +K I+ SQW  +L + E   +++    L + G+L  + R      FN     Q  ILL
Sbjct: 1126 SGEKSIVFSQWTSFLDLLEIPLRRRGFEFLRFDGKLAQKGREKVLKEFNETK--QKTILL 1183

Query: 715  LSIKCGGVGLNLIGGNTL 768
            +S+K GGVGLNL   +++
Sbjct: 1184 MSLKAGGVGLNLTAASSV 1201



 Score = 31.9 bits (69), Expect = 0.50
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +2

Query: 227  THGRVCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQ 406
            T  +V  C  +E E+  Y  L   S+  + + VA  +       L    ++L L+L+LRQ
Sbjct: 927  TDVQVIECEQSEAERDFYTALFKRSKVQFDQFVAQGKV------LHNYANILELLLRLRQ 980

Query: 407  ICCHPYLAM 433
             C HP+L M
Sbjct: 981  CCNHPFLVM 989


>At1g11100.1 68414.m01271 SNF2 domain-containing protein / helicase
            domain-containing protein / zinc finger protein-related
            similar to RUSH-1alpha [Oryctolagus cuniculus]
            GI:1655930; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain
          Length = 1226

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN------NDSTNRIKS 167
            L A  RWC++GTPI N   D+YS   FL+  P++  + +    KN       +    +++
Sbjct: 739  LHAKRRWCLSGTPIQNSIADLYSYFRFLKYDPYSSYQTFCETIKNPISSYPGEGYKTLQA 798

Query: 168  IIKKIVLKRDKSEI-----SFNIPKHTVEYVHVNLMKKKK 272
            I+KK++L+R K  +       ++P  ++E   V+  K+++
Sbjct: 799  ILKKVMLRRTKDTLLDGKPVISLPPKSIELRRVDFTKEER 838



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 22/80 (27%), Positives = 41/80 (51%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            V  ++N + +K I+ +QW + L + E   K   I    + G++ V  R  A   FN   D
Sbjct: 1063 VGGVVNVAGEKAIVFTQWTKMLDLLEAGLKSSGIQYRRFDGKMTVPARDAAVQDFNTLPD 1122

Query: 694  TQHRILLLSIKCGGVGLNLI 753
                ++++S+K   +GLN++
Sbjct: 1123 VS--VMIMSLKAASLGLNMV 1140



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F +EE+  Y KL+C+S + + +   A     T+   Q   ++L ++L+LRQ C HP L
Sbjct: 833 FTKEERDFYSKLECDSRDQFKEYAEA----GTVK--QNYVNILLMLLRLRQACGHPLL 884


>At3g19210.1 68416.m02438 DNA repair protein RAD54, putative similar
           to RAD54 GB:CAA71278 from [Drosophila melanogaster]
           (Mol. Cell. Biol.(1997) 17 (10), 6097-6104)
          Length = 852

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 27/88 (30%), Positives = 43/88 (48%)
 Frame = +1

Query: 505 AHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN 684
           + L+ ++   +DD+I+LVS + + L +F    +++    L   G   +  R       N+
Sbjct: 436 SRLLANLRRKTDDRIVLVSNYTQTLDLFAQLCRERRYPFLRLDGSTTISKRQKLVNRLND 495

Query: 685 AADTQHRILLLSIKCGGVGLNLIGGNTL 768
               +    LLS K GG GLNLIG N L
Sbjct: 496 PTKDEF-AFLLSSKAGGCGLNLIGANRL 522


>At1g61140.1 68414.m06888 SNF2 domain-containing protein / helicase
            domain-containing protein / zinc finger protein-related
            similar to ATPase [Homo sapiens] GI:531196; contains Pfam
            profiles PF00271: Helicase conserved C-terminal domain,
            PF00176: SNF2 family N-terminal domain, PF00097: Zinc
            finger, C3HC4 type (RING finger)
          Length = 1287

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIK------S 167
            L A  RWC++GTPI N   D+YS   FL+  P++   ++    KN  + N +K      +
Sbjct: 819  LRAKRRWCLSGTPIQNSIDDLYSYFRFLKYDPYSSYVLFCSTIKNPITRNPVKGYQKLQA 878

Query: 168  IIKKIVLKRDKSEI 209
            I+K ++L+R K  +
Sbjct: 879  ILKTVMLRRTKGSL 892



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/94 (25%), Positives = 43/94 (45%)
 Frame = +1

Query: 472  NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVE 651
            +GL    V+     VD  +  + +K I+ SQW + L + E      +I      G + V 
Sbjct: 1108 SGLSITPVKNEGMSVDVPIKVAGEKAIVFSQWTKMLNLLEASLVSSHIQYRRLDGTMSVA 1167

Query: 652  DRILAETTFNNAADTQHRILLLSIKCGGVGLNLI 753
             R  A   FN   +    ++++S+K   +GLN++
Sbjct: 1168 ARDKAVQDFNTLPEV--TVMIMSLKAASLGLNMV 1199



 Score = 34.3 bits (75), Expect = 0.094
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +2

Query: 254  FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
            F  EE+  Y KL+ ES   +      RE     +  Q   ++L ++L+LRQ C HP L
Sbjct: 913  FTVEERDFYSKLEAESRTQF------REYAEAGTVKQNYVNILLMLLRLRQACDHPLL 964


>At5g66750.1 68418.m08414 SNF2 domain-containing protein / helicase
           domain-containing protein similar to
           proliferation-associated SNF2-like protein [Homo
           sapiens] GI:8980660; contains Pfam profiles PF00271:
           Helicase conserved C-terminal domain, PF00176: SNF2
           family N-terminal domain
          Length = 764

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 23/80 (28%), Positives = 43/80 (53%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  ++ K+++ SQW + L I + +F +K        G +K+++R      F++   +   
Sbjct: 536 LFANNHKVLIFSQWTKLLDIMDYYFSEKGFEVCRIDGSVKLDERRRQIKDFSDEKSSCS- 594

Query: 706 ILLLSIKCGGVGLNLIGGNT 765
           I LLS + GG+G+NL   +T
Sbjct: 595 IFLLSTRAGGLGINLTAADT 614



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 22/107 (20%), Positives = 52/107 (48%), Gaps = 17/107 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPF---NDPRVW-KMLNKN-NDST------ 152
           L   N+  +TGTP+ N   +++S++NF+    F   ++   W     KN N++T      
Sbjct: 352 LKMDNKLLLTGTPLQNNLSELWSLLNFILPDIFTSHDEFESWFDFSEKNKNEATKEEEEK 411

Query: 153 ------NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
                 +++  I++  +L+R K ++  ++P+     ++  +   +K+
Sbjct: 412 RRAQVVSKLHGILRPFILRRMKCDVELSLPRKKEIIMYATMTDHQKK 458


>At1g05120.1 68414.m00514 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to SP|P79051 DNA
           repair protein rhp16 (RAD16 homolog)
           {Schizosaccharomyces pombe}; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain, PF00097: Zinc finger,
           C3HC4 type (RING finger)
          Length = 833

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 18/35 (51%), Positives = 27/35 (77%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN 107
           AL AT RW ++GTP+ N+  ++YS+I FLQ RP++
Sbjct: 378 ALEATYRWALSGTPLQNRVGELYSLIRFLQIRPYS 412



 Score = 35.1 bits (77), Expect = 0.054
 Identities = 20/69 (28%), Positives = 33/69 (47%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K I+ SQ+  +L +      +  ++ +   G + +  R  A   F    D   R+ L+S+
Sbjct: 682 KAIVFSQFTSFLDLINYTLGKCGVSCVQLVGSMTMAARDTAINKFKEDPDC--RVFLMSL 739

Query: 724 KCGGVGLNL 750
           K GGV LNL
Sbjct: 740 KAGGVALNL 748


>At3g16600.1 68416.m02122 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to SP|P31244 DNA
           repair protein RAD16 {Saccharomyces cerevisiae};
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 638

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 6/77 (7%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN-----DPRVWKMLNKNN-DSTNRIK 164
           +L A  RWC+TGTPI NK  D+YS   FL+  P+        R+   ++K       +++
Sbjct: 237 SLRAKRRWCLTGTPIKNKVDDLYSYFRFLRYHPYAMCNSFHQRIKAPIDKKPLHGYKKLQ 296

Query: 165 SIIKKIVLKRDKSEISF 215
           +I++ I+L+R K E SF
Sbjct: 297 AILRGIMLRRTK-EWSF 312



 Score = 27.9 bits (59), Expect = 8.1
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +2

Query: 263 EEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           +E + Y KL+  S   + +  A    + TL   + M ++L ++L+LRQ C HP L
Sbjct: 308 KEWSFYRKLELNSRWKFEEYAA----DGTLH--EHMAYLLVMLLRLRQACNHPQL 356


>At2g40770.1 68415.m05030 SNF2 domain-containing protein / helicase
           domain-containing protein / zinc finger (C3HC4 type RING
           finger) family protein low similarity to SP|P36607 DNA
           repair protein rad8 {Schizosaccharomyces pombe};
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00628: PHD-finger, PF00097: Zinc finger, C3HC4
           type (RING finger)
          Length = 1648

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW 122
           L   +RWCITGTPI  K  D++ ++ FL+  PF+  R W
Sbjct: 609 LYTKHRWCITGTPIQRKLDDLFGLLKFLKANPFDVSRWW 647



 Score = 31.9 bits (69), Expect = 0.50
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 338 SENTLSRLQQMQHVLWLILKLRQICCHPYLAMHGRNLLE 454
           S+N L    +   +L  +LKLRQ CCHP +   G   L+
Sbjct: 738 SDNPLVTHAEAAKLLNSLLKLRQACCHPQVGSSGLRSLQ 776



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 9/79 (11%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA------ETTFNNAADTQHR 705
            K+++ S W + L + E+ F   +I  +   G  K +  I        ET   N+   + +
Sbjct: 1435 KVLVFSSWNDVLDVLEHAFAANSITCIRMKGGRKSQTAISKFKGSEKETQKTNSHQKEEK 1494

Query: 706  ---ILLLSIKCGGVGLNLI 753
               +LLL ++ G  GLNL+
Sbjct: 1495 SIQVLLLLVQHGANGLNLL 1513


>At2g02090.1 68415.m00145 SNF2 domain-containing protein / helicase
           domain-containing protein similar to transcriptional
           activator SRCAP [Homo sapiens] GI:5106572; contains Pfam
           profiles PF00271: Helicase conserved C-terminal domain,
           PF00176: SNF2 family N-terminal domain
          Length = 763

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 30/91 (32%), Positives = 42/91 (46%)
 Frame = +1

Query: 496 QTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETT 675
           +T A L+   +  S  ++++ SQW   L I E       +      G  +V DR     T
Sbjct: 591 RTLAELLPS-MKKSGHRVLIFSQWTSMLDILEWTLDVIGVTYRRLDGSTQVTDRQTIVDT 649

Query: 676 FNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
           FNN  D      LLS + GG GLNL G +T+
Sbjct: 650 FNN--DKSIFACLLSTRAGGQGLNLTGADTV 678



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 5/95 (5%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRV--WKMLN-KNNDSTNRIKSII 173
           A  A  R  +TGTP+ N   +++S++ F+    F    V   K+LN ++ +   R+KSI+
Sbjct: 373 ARNANQRLMLTGTPLQNDLHELWSLLEFMLPDIFTTENVDLKKLLNAEDTELITRMKSIL 432

Query: 174 KKIVLKRDKSEISFN-IPK-HTVEYVHVNLMKKKK 272
              +L+R KS++    +PK   VEYV   LM++K+
Sbjct: 433 GPFILRRLKSDVMQQLVPKIQRVEYV---LMERKQ 464


>At2g44980.1 68415.m05600 transcription regulatory protein SNF2,
           putative similar to SNF2P [Oryza sativa (japonica
           cultivar-group)] GI:23193483; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain; CG donor site annotated
           in one isoform based on protein alignments.
          Length = 851

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/81 (27%), Positives = 42/81 (51%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L+ S  +++L SQ    L I ++F + +  +     G ++ E+R  A   F+        
Sbjct: 380 LHDSGHRVLLFSQMTSTLDILQDFMELRRYSYERLDGSVRAEERFAAIKNFSVDGSNAF- 438

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + ++S + GGVGLNL+  +T+
Sbjct: 439 VFMISTRAGGVGLNLVAADTV 459


>At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar to
           DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00249: Myb-like DNA-binding domain
          Length = 1072

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 6   LTATN-RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRV---WKMLNKNNDS---TNRIK 164
           L +TN R  ITGTP+ N   ++++++NFL    F+       W  ++  ND      ++ 
Sbjct: 340 LFSTNYRLLITGTPLQNNLHELWALLNFLLPEVFSSAETFDEWFQISGENDQQEVVQQLH 399

Query: 165 SIIKKIVLKRDKSEISFNIP--KHTVEYVHVNLMKKK 269
            +++  +L+R KS++   +P  K T+  V ++ M+K+
Sbjct: 400 KVLRPFLLRRLKSDVEKGLPPKKETILKVGMSQMQKQ 436



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 18/75 (24%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L   D ++++ SQ    L I E++   +        G    ++R  +   +N     +  
Sbjct: 507 LKDRDSRVLIFSQMTRLLDILEDYLMYRGYQYCRIDGNTGGDERDASIEAYNKPGSEKF- 565

Query: 706 ILLLSIKCGGVGLNL 750
           + LLS + GG+G+NL
Sbjct: 566 VFLLSTRAGGLGINL 580


>At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar to
           DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00249: Myb-like DNA-binding domain
          Length = 1069

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 6   LTATN-RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRV---WKMLNKNNDS---TNRIK 164
           L +TN R  ITGTP+ N   ++++++NFL    F+       W  ++  ND      ++ 
Sbjct: 340 LFSTNYRLLITGTPLQNNLHELWALLNFLLPEVFSSAETFDEWFQISGENDQQEVVQQLH 399

Query: 165 SIIKKIVLKRDKSEISFNIP--KHTVEYVHVNLMKKK 269
            +++  +L+R KS++   +P  K T+  V ++ M+K+
Sbjct: 400 KVLRPFLLRRLKSDVEKGLPPKKETILKVGMSQMQKQ 436



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 18/75 (24%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L   D ++++ SQ    L I E++   +        G    ++R  +   +N     +  
Sbjct: 507 LKDRDSRVLIFSQMTRLLDILEDYLMYRGYQYCRIDGNTGGDERDASIEAYNKPGSEKF- 565

Query: 706 ILLLSIKCGGVGLNL 750
           + LLS + GG+G+NL
Sbjct: 566 VFLLSTRAGGLGINL 580


>At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family
            protein / CHD family protein similar to chromatin
            remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana]
            GI:6478518; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo'
            (CHRromatin Organization MOdifier)
          Length = 2228

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 5/85 (5%)
 Frame = +3

Query: 18   NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTN-----RIKSIIKKI 182
            +R  +TGTP+ N   +MY+++NFLQ  P + P +     + +D T+      +K ++   
Sbjct: 838  HRVLLTGTPLQNNIGEMYNLLNFLQ--PSSFPSLSSFEERFHDLTSAEKVEELKKLVAPH 895

Query: 183  VLKRDKSEISFNIPKHTVEYVHVNL 257
            +L+R K +   NIP  T   V V L
Sbjct: 896  MLRRLKKDAMQNIPPKTERMVPVEL 920



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 4/94 (4%)
 Frame = +1

Query: 499  TSAHLVDDILNTSDDKIILVSQWVEYLKIFENF----FKQKNIATLMYTGQLKVEDRILA 666
            T  H +  +L+    ++++ SQ  + L I E++    F  K    +   G + V DR  A
Sbjct: 993  TLLHSMLKVLHKEGHRVLIFSQMTKLLDILEDYLNIEFGPKTFERV--DGSVAVADRQAA 1050

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
               FN   D    + LLS +  G+G+NL   +T+
Sbjct: 1051 IARFNQ--DKNRFVFLLSTRACGLGINLATADTV 1082


>At3g06400.1 68416.m00738 DNA-dependent ATPase, putative similar to
           DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00249: Myb-like DNA-binding domain
          Length = 1055

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 6   LTATN-RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRV---WKMLNKNNDS---TNRIK 164
           L +TN R  ITGTP+ N   ++++++NFL    F+       W  ++  ND      ++ 
Sbjct: 335 LFSTNYRLLITGTPLQNNLHELWALLNFLLPEIFSSAETFDEWFQISGENDQQEVVQQLH 394

Query: 165 SIIKKIVLKRDKSEISFNIP--KHTVEYVHVNLMKKK 269
            +++  +L+R KS++   +P  K T+  V ++ M+K+
Sbjct: 395 KVLRPFLLRRLKSDVEKGLPPKKETILKVGMSQMQKQ 431



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 18/75 (24%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L   D ++++ SQ    L I E++   +        G    ++R  +   +N     +  
Sbjct: 502 LKERDSRVLIFSQMTRLLDILEDYLMYRGYLYCRIDGNTGGDERDASIEAYNKPGSEKF- 560

Query: 706 ILLLSIKCGGVGLNL 750
           + LLS + GG+G+NL
Sbjct: 561 VFLLSTRAGGLGINL 575


>At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to transcription
           factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 981

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTN------RIKS 167
           L A  RWC++GTPI N   D+YS   FL+  P+   + +    K   S N      ++++
Sbjct: 496 LRAKRRWCLSGTPIQNTIDDLYSYFRFLKYDPYAVYKSFCHQIKGPISRNSLQGYKKLQA 555

Query: 168 IIKKIVLKRDKSEI-----SFNIPKHTVEYVHVNLMKKKK 272
           +++ I+L+R K  +       N+P  T+    V+   +++
Sbjct: 556 VLRAIMLRRTKGTLLDGQPIINLPPKTINLSQVDFSVEER 595



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ SQW   L + E    + +I      G + +  R  A   F+N  D   +++++S+
Sbjct: 828  KTIIFSQWTGMLDLVELSLIENSIEFRRLDGTMSLIARDRAVKEFSNDPDV--KVMIMSL 885

Query: 724  KCGGVGLNLI 753
            K G +GLN+I
Sbjct: 886  KAGNLGLNMI 895



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 22/58 (37%), Positives = 34/58 (58%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+ EE++ Y KL+ +S   + KA AA  + N     Q   ++L ++L+LRQ C HP L
Sbjct: 590 FSVEERSFYVKLESDSRSQF-KAYAAAGTLN-----QNYANILLMLLRLRQACDHPQL 641


>At2g46020.2 68415.m05725 transcription regulatory protein SNF2,
            putative similar to SP|P22082 Transcription regulatory
            protein SNF2 (SWI/SNF complex component SNF2)
            {Saccharomyces cerevisiae}; contains Pfam profiles
            PF00271: Helicase conserved C-terminal domain, PF00176:
            SNF2 family N-terminal domain
          Length = 2193

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 26/81 (32%), Positives = 40/81 (49%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  +++L S   + L I E + + + +      G   +EDR  A   FN+  DT   
Sbjct: 1320 LQRTGHRVLLFSTMTKLLDILEEYLQWRRLVYRRIDGTTSLEDRESAIVDFNDP-DTDCF 1378

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLSI+  G GLNL   +T+
Sbjct: 1379 IFLLSIRAAGRGLNLQTADTV 1399


>At2g46020.1 68415.m05724 transcription regulatory protein SNF2,
            putative similar to SP|P22082 Transcription regulatory
            protein SNF2 (SWI/SNF complex component SNF2)
            {Saccharomyces cerevisiae}; contains Pfam profiles
            PF00271: Helicase conserved C-terminal domain, PF00176:
            SNF2 family N-terminal domain
          Length = 2192

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 26/81 (32%), Positives = 40/81 (49%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  +++L S   + L I E + + + +      G   +EDR  A   FN+  DT   
Sbjct: 1319 LQRTGHRVLLFSTMTKLLDILEEYLQWRRLVYRRIDGTTSLEDRESAIVDFNDP-DTDCF 1377

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLSI+  G GLNL   +T+
Sbjct: 1378 IFLLSIRAAGRGLNLQTADTV 1398


>At1g03750.1 68414.m00355 helicase, putative similar to SP|Q03468
           Excision repair protein ERCC-6 (Cockayne syndrome
           protein CSB) {Homo sapiens}; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain, PF02810: SEC-C motif
          Length = 862

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 26/74 (35%), Positives = 34/74 (45%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           DKI+L S  V  L I E F  +K  +     G      R      FN  A    ++ L+S
Sbjct: 545 DKILLFSYSVRMLDILEKFLIRKGYSFARLDGSTPTNLRQSLVDDFN--ASPSKQVFLIS 602

Query: 721 IKCGGVGLNLIGGN 762
            K GG+GLNL+  N
Sbjct: 603 TKAGGLGLNLVSAN 616


>At3g20010.1 68416.m02531 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to transcription
           factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 1047

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 6/74 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTN------RIKS 167
           L A  RWC++GTPI N   D+YS   FL+  P+   + +    K   S N      ++++
Sbjct: 567 LRAKRRWCLSGTPIQNTIDDLYSYFRFLRYDPYAVYKSFYSTIKVPISRNSCQGYKKLQA 626

Query: 168 IIKKIVLKRDKSEI 209
           +++ I+L+R K  +
Sbjct: 627 VLRAIMLRRTKGTL 640



 Score = 35.9 bits (79), Expect = 0.031
 Identities = 23/58 (39%), Positives = 33/58 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+  E++ Y KL+ +S   + KA A      TLS  Q   ++L L+L+LRQ C HP L
Sbjct: 661 FSVAERSFYKKLEADSRSQF-KAYA---DAGTLS--QNYANILLLLLRLRQACDHPQL 712


>At2g28290.2 68415.m03434 chromatin remodeling protein, putative (SYD)
            similar to transcriptional activator HBRM [Homo sapiens]
            GI:414117; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain; identical to cDNA putative chromatin
            remodeling protein SYD (SPLAYED) GI:13603720
          Length = 3529

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 25/81 (30%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +D +++  S     L + E++   K    L   GQ    DR      FN +  +   
Sbjct: 1085 LKATDHRVLFFSTMTRLLDVMEDYLTLKGYKYLRLDGQTSGGDRGALIDGFNKSG-SPFF 1143

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLSI+ GGVG+NL   +T+
Sbjct: 1144 IFLLSIRAGGVGVNLQAADTV 1164



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 20/92 (21%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW--KMLNKNNDST-------- 152
            +++R  +TGTP+ N   ++++++NFL    FN   D   W  K    N +S+        
Sbjct: 905  SSHRLLLTGTPLQNNLEELWALLNFLLPNIFNSSEDFSQWFNKPFQSNGESSAEEALLSE 964

Query: 153  -------NRIKSIIKKIVLKRDKSEISFNIPK 227
                   NR+  +++  VL+R K ++   +P+
Sbjct: 965  EENLLIINRLHQVLRPFVLRRLKHKVENELPE 996



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = +2

Query: 257  NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLW-LILKLRQICCHPYLA 430
            NE  + +   ++CE+  AY K +  R  +N  S        +   +++LR IC HPYL+
Sbjct: 992  NELPEKIERLIRCEAS-AYQKLLMKRVEDNLGSIGNAKSRAVHNSVMELRNICNHPYLS 1049


>At2g28290.1 68415.m03433 chromatin remodeling protein, putative (SYD)
            similar to transcriptional activator HBRM [Homo sapiens]
            GI:414117; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain; identical to cDNA putative chromatin
            remodeling protein SYD (SPLAYED) GI:13603720
          Length = 3574

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 25/81 (30%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +D +++  S     L + E++   K    L   GQ    DR      FN +  +   
Sbjct: 1085 LKATDHRVLFFSTMTRLLDVMEDYLTLKGYKYLRLDGQTSGGDRGALIDGFNKSG-SPFF 1143

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLSI+ GGVG+NL   +T+
Sbjct: 1144 IFLLSIRAGGVGVNLQAADTV 1164



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 20/92 (21%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW--KMLNKNNDST-------- 152
            +++R  +TGTP+ N   ++++++NFL    FN   D   W  K    N +S+        
Sbjct: 905  SSHRLLLTGTPLQNNLEELWALLNFLLPNIFNSSEDFSQWFNKPFQSNGESSAEEALLSE 964

Query: 153  -------NRIKSIIKKIVLKRDKSEISFNIPK 227
                   NR+  +++  VL+R K ++   +P+
Sbjct: 965  EENLLIINRLHQVLRPFVLRRLKHKVENELPE 996



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = +2

Query: 257  NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLW-LILKLRQICCHPYLA 430
            NE  + +   ++CE+  AY K +  R  +N  S        +   +++LR IC HPYL+
Sbjct: 992  NELPEKIERLIRCEAS-AYQKLLMKRVEDNLGSIGNAKSRAVHNSVMELRNICNHPYLS 1049


>At2g18760.1 68415.m02184 SNF2 domain-containing protein / helicase
           domain-containing protein similar to SP|Q03468 Excision
           repair protein ERCC-6 (Cockayne syndrome protein CSB)
           {Homo sapiens}; contains PFam profiles PF00271: Helicase
           conserved C-terminal domain, PF00176: SNF2 family
           N-terminal domain
          Length = 1187

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 23/73 (31%), Positives = 36/73 (49%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           +++L SQ  + L I E+F      +     G   V+ R+     FNN+ D    + +L+ 
Sbjct: 745 RVLLFSQTQQMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSEDM--FVFVLTT 802

Query: 724 KCGGVGLNLIGGN 762
           K GG+G NL G N
Sbjct: 803 KVGGLGTNLTGAN 815


>At5g19310.1 68418.m02301 homeotic gene regulator, putative similar
           to SP|P25439 Homeotic gene regulator (Brahma protein)
           {Drosophila melanogaster}; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain
          Length = 1064

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +  +I+L SQ    + + E +    +   L   G  K + R +    FN   D+ + 
Sbjct: 707 LKKAGHRILLFSQMTRLIDLLEIYLSLNDYMYLRLDGSTKTDQRGILLKQFNEP-DSPYF 765

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GG+GLNL   +T+
Sbjct: 766 MFLLSTRAGGLGLNLQTADTI 786



 Score = 31.1 bits (67), Expect = 0.87
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 15/86 (17%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW----------KMLNKNND--STN 155
           R  +TGTPI N   +++S++NFL    FN   +   W            L    +    N
Sbjct: 538 RLLLTGTPIQNSLQELWSLLNFLLPHIFNSIHNFEEWFNTPFAECGSASLTDEEELLIIN 597

Query: 156 RIKSIIKKIVLKRDKSEISFNIPKHT 233
           R+  +I+  +L+R KSE+   +P  T
Sbjct: 598 RLHHVIRPFLLRRKKSEVEKFLPGKT 623


>At3g06010.1 68416.m00686 homeotic gene regulator, putative similar
           to SP|P25439 Homeotic gene regulator (Brahma protein)
           {Drosophila melanogaster}; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain
          Length = 1132

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +  +I+L SQ    + + E +    +   L   G  K + R L    FN   D+ + 
Sbjct: 755 LRKAGHRILLFSQMTRLIDVLEIYLTLNDYKYLRLDGTTKTDQRGLLLKQFNEP-DSPYF 813

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GG+GLNL   +T+
Sbjct: 814 MFLLSTRAGGLGLNLQTADTV 834



 Score = 31.9 bits (69), Expect = 0.50
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 15/86 (17%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPR---VW---KMLNKNNDS---------TN 155
           R  +TGTPI N   +++S++NFL    FN  +    W      ++ N S          +
Sbjct: 586 RLLLTGTPIQNSLQELWSLLNFLLPHIFNSVQNFEEWFNAPFADRGNVSLTDEEELLIIH 645

Query: 156 RIKSIIKKIVLKRDKSEISFNIPKHT 233
           R+  +I+  +L+R K E+   +P  T
Sbjct: 646 RLHHVIRPFILRRKKDEVEKFLPGKT 671


>At3g57300.1 68416.m06378 transcriptional activator, putative similar
            to transcriptional activator SRCAP [Homo sapiens]
            GI:5106572; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain
          Length = 1507

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/81 (25%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L   + +++L +Q  + L I E++   +    L   G   + DR      F + +D    
Sbjct: 1218 LRAGNHRVLLFAQMTKMLNILEDYMNYRKYKYLRLDGSSTIMDRRDMVRDFQHRSDIF-- 1275

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1276 VFLLSTRAGGLGINLTAADTV 1296



 Score = 35.1 bits (77), Expect = 0.054
 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 13/98 (13%)
 Frame = +3

Query: 18   NRWCITGTPIHNKHWDMYSMINFLQCRPF-NDPRVWKMLNK------------NNDSTNR 158
            NR  +TGTPI N   +++++++F+    F N  +  +  +K            N    NR
Sbjct: 743  NRLLLTGTPIQNNMAELWALLHFIMPMLFDNHDQFNEWFSKGIENHAEHGGTLNEHQLNR 802

Query: 159  IKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
            + +I+K  +L+R K ++   +   T   VH  L  +++
Sbjct: 803  LHAILKPFMLRRVKKDVVSELTTKTEVTVHCKLSSRQQ 840


>At2g44980.2 68415.m05601 transcription regulatory protein SNF2,
           putative similar to SNF2P [Oryza sativa (japonica
           cultivar-group)] GI:23193483; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain; CG donor site annotated
           in one isoform based on protein alignments.
          Length = 870

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 9/90 (10%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD---- 693
           L+ S  +++L SQ    L I ++F + +  +     G ++ E+R  A   F+   +    
Sbjct: 389 LHDSGHRVLLFSQMTSTLDILQDFMELRRYSYERLDGSVRAEERFAAIKNFSAKTERGLD 448

Query: 694 -----TQHRILLLSIKCGGVGLNLIGGNTL 768
                +   + ++S + GGVGLNL+  +T+
Sbjct: 449 SEVDGSNAFVFMISTRAGGVGLNLVAADTV 478


>At4g31900.1 68417.m04533 chromatin remodeling factor, putative
           strong similarity to chromatin remodeling factor CHD3
           (PICKLE) [Arabidopsis thaliana] GI:6478518; contains
           Pfam profiles PF00271: Helicase conserved C-terminal
           domain, PF00176: SNF2 family N-terminal domain
          Length = 1202

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 21/81 (25%), Positives = 41/81 (50%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ +Q+   L + E++F  KN       G++   +R +    FN A ++   
Sbjct: 536 LKEQGHRVLIYTQFQHTLYLLEDYFTFKNWNYERIDGKISGPERQVRIDRFN-AENSNRF 594

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 595 CFLLSTRAGGIGINLATADTV 615



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 17/82 (20%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIVLKRDKSEI 209
           +TGTP+ N   +++++++FL    F     ++ +NK  +  +R+  ++   +L+R K ++
Sbjct: 383 LTGTPLQNNLNELFALMHFLDADKFGSLEKFQDINK-EEQISRLHQMLAPHLLRRLKKDV 441

Query: 210 -SFNIPKHTVEYVHVNLMKKKK 272
               +P      + V++  ++K
Sbjct: 442 LKDKVPPKKELILRVDMSSQQK 463



 Score = 31.1 bits (67), Expect = 0.87
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = +2

Query: 260 EEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++E  L   +  + +E Y   +       T  R  ++ +VL   +KLRQ+C HPYL
Sbjct: 449 KKELILRVDMSSQQKEVYKAVITNNYQVLTKKRDAKISNVL---MKLRQVCSHPYL 501


>At3g54280.1 68416.m05999 SNF2 domain-containing protein / helicase
            domain-containing protein similar to SP|O14981
            TBP-associated factor 172 (TAF-172) (TAF(II)170) {Homo
            sapiens}; contains PFam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain
          Length = 2049

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 3/100 (3%)
 Frame = +1

Query: 478  LYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKV 648
            L E  + + A   D  L+    ++++ +Q    L I E    Q ++ ++ Y    G +  
Sbjct: 1803 LEECGIGSDASSSDGTLSVGQHRVLIFAQHKALLDIIEKDLFQAHMKSVTYMRLDGSVVP 1862

Query: 649  EDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            E R      FN+  D    +LLL+   GG+GLNL   +TL
Sbjct: 1863 EKRFEIVKAFNS--DPTIDVLLLTTHVGGLGLNLTSADTL 1900


>At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding family
            protein / CHD family protein similar to SP|O14647
            Chromodomain-helicase-DNA-binding protein 2 (CHD-2) {Homo
            sapiens}; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain, PF00385: 'chromo' (CHRromatin
            Organization MOdifier)
          Length = 1722

 Score = 35.9 bits (79), Expect = 0.031
 Identities = 23/81 (28%), Positives = 35/81 (43%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ V  L I   +   +        G  K E R  A   FN  A     
Sbjct: 949  LRETKHRVLIFSQMVRMLDILAEYLSLRGFQFQRLDGSTKAELRQQAMDHFNAPASDDF- 1007

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1008 CFLLSTRAGGLGINLATADTV 1028



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 19/91 (20%), Positives = 45/91 (49%), Gaps = 5/91 (5%)
 Frame = +3

Query: 18   NRWCITGTPIHNKHWDMYSMINFLQCRPFNDP----RVWKMLNKNNDS-TNRIKSIIKKI 182
            N+  ITGTP+ N   +++++++FL    F +       +K L+  N+S    +   ++  
Sbjct: 781  NKLLITGTPLQNSVEELWALLHFLDPGKFKNKDEFVENYKNLSSFNESELANLHLELRPH 840

Query: 183  VLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            +L+R   ++  ++P      + V +   +K+
Sbjct: 841  ILRRVIKDVEKSLPPKIERILRVEMSPLQKQ 871


>At3g12810.1 68416.m01598 SNF2 domain-containing protein / helicase
            domain-containing protein similar to transcriptional
            activator SRCAP [Homo sapiens] GI:5106572; contains Pfam
            profiles PF00271: Helicase conserved C-terminal domain,
            PF00176: SNF2 family N-terminal domain
          Length = 2055

 Score = 35.1 bits (77), Expect = 0.054
 Identities = 19/75 (25%), Positives = 36/75 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            + ++ +Q  + L + E F        +   G    E+R      FN   + +  + +LS 
Sbjct: 1093 RALIFTQMTKMLDVLEAFINLYGYTYMRLDGSTPPEERQTLMQRFNT--NPKIFLFILST 1150

Query: 724  KCGGVGLNLIGGNTL 768
            + GGVG+NL+G +T+
Sbjct: 1151 RSGGVGINLVGADTV 1165



 Score = 31.5 bits (68), Expect = 0.66
 Identities = 19/78 (24%), Positives = 40/78 (51%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMH 436
           ++ E  ++ +L       Y   +A+ E++ TL+       ++ +I++LR++C HP L   
Sbjct: 769 SKHEHVIFCRLSKRQRNLYEDFIASTETQATLTS-GSFFGMISIIMQLRKVCNHPDL-FE 826

Query: 437 GRNLLETNDCFKMDYMSS 490
           GR ++ + D   +D   S
Sbjct: 827 GRPIVSSFDMAGIDVQLS 844


>At1g02670.1 68414.m00217 DNA repair protein, putative similar to
           SP|P79051 DNA repair protein rhp16 (RAD16 homolog)
           {Schizosaccharomyces pombe}; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain
          Length = 678

 Score = 34.7 bits (76), Expect = 0.071
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K I+ SQ+  +L +      +  ++ +   G +    +  A   F    D   R+LL+S+
Sbjct: 527 KAIVFSQFTSFLDLISYALGKSGVSCVQLVGSMSKAAKDAALKNFKEEPDC--RVLLMSL 584

Query: 724 KCGGVGLNL 750
           + GGV LNL
Sbjct: 585 QAGGVALNL 593



 Score = 34.3 bits (75), Expect = 0.094
 Identities = 12/28 (42%), Positives = 21/28 (75%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINF 86
           AL AT RW ++GTP+ N   ++YS++++
Sbjct: 293 ALEATYRWALSGTPLQNDVDELYSLVSY 320


>At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKLE)
           identical to chromatin remodeling factor CHD3
           [Arabidopsis thaliana] GI:6478518
          Length = 1384

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 19/92 (20%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
 Frame = +3

Query: 9   TATNRWCITGTPIHNKHWDMYSMINFLQCRPFND----PRVWKMLNKNNDSTNRIKSIIK 176
           ++ +R  +TGTP+ N   +++ +++FL    F         +K +N+  +  +R+  ++ 
Sbjct: 442 SSNHRILLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQ-EEQISRLHKMLA 500

Query: 177 KIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             +L+R K ++  ++P      + V+L   +K
Sbjct: 501 PHLLRRVKKDVMKDMPPKKELILRVDLSSLQK 532



 Score = 31.5 bits (68), Expect = 0.66
 Identities = 19/81 (23%), Positives = 39/81 (48%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ +Q+   L + E++   K        G++   +R +    FN A ++   
Sbjct: 607 LKEQGHRVLIYTQFQHMLDLLEDYCTHKKWQYERIDGKVGGAERQIRIDRFN-AKNSNKF 665

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 666 CFLLSTRAGGLGINLATADTV 686



 Score = 31.1 bits (67), Expect = 0.87
 Identities = 14/58 (24%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +2

Query: 302 EEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMHGRNLL-ETNDCFK 472
           ++ Y KA+  R  +    +      +  ++++LR++CCHPY+      ++ + N+ FK
Sbjct: 531 QKEYYKAIFTRNYQVLTKKGGAQISLNNIMMELRKVCCHPYMLEGVEPVIHDANEAFK 588


>At1g17120.1 68414.m02086 amino acid permease family protein low
           similarity to SP|O43246 Cationic amino acid
           transporter-4 (CAT-4) {Homo sapiens}; contains Pfam
           profile PF00324: Amino acid permease
          Length = 590

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 275 LYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWL 388
           L D+L   S +AY    A RESEN + R      +LWL
Sbjct: 56  LADRLLSRSSDAYELDAARRESENPMRRCLTWWDLLWL 93


>At3g54460.1 68416.m06025 SNF2 domain-containing protein / helicase
           domain-containing protein / F-box family protein similar
           to SP|P36607 DNA repair protein rad8
           {Schizosaccharomyces pombe}; contains Pfam profiles
           PF00271: Helicase conserved C-terminal domain, PF00176:
           SNF2 family N-terminal domain, PF00646: F-box domain
          Length = 1378

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 5/46 (10%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYS----MINFLQCRPFND-PRVWK 125
           +LTA NRW +TGTP  N      S    ++ FL    + + P+ W+
Sbjct: 854 SLTACNRWLLTGTPTPNTPNSQLSHIQPLLKFLHEEVYGENPKFWE 899


>At1g36675.1 68414.m04563 glycine-rich protein 
          Length = 268

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 532 TSDDKIILVSQWVEYLKIFENF-FKQKNIATLMYTGQLKVEDRILAETTFNNAADT 696
           T+D  ++L+S+W++Y +I      K+ N+  +  +G  K      A   ++NA +T
Sbjct: 79  TTDQNLVLLSRWIKYEQIVSLVETKKDNVKRMQQSGWSKDGVLAKAHELYSNAGNT 134


>At4g25120.1 68417.m03614 UvrD/REP helicase family protein contains
           Pfam PF00580: UvrD/REP helicase
          Length = 1122

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 13/47 (27%), Positives = 25/47 (53%)
 Frame = +2

Query: 248 C*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWL 388
           C   EEE  + +K  C    +++  ++ RE+EN  SR +  ++ + L
Sbjct: 773 CTTTEEEDAIKEKKGCNQLHSFINYISERETENFRSRRRDNENSVTL 819


>At1g48310.1 68414.m05396 SNF2 domain-containing protein / helicase
           domain-containing protein contains similarity to
           DNA-dependent ATPase A GI:6651385 from [Bos taurus]};
           contains PFam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2
          Length = 673

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 16/75 (21%), Positives = 32/75 (42%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K ++ +     L+    F K+K +  +   G      R    + F +  + +  +L  SI
Sbjct: 486 KFLVFAHHQSMLEELHQFLKKKKVGCIRIDGSTPASSRQALVSDFQDKDEIKAAVL--SI 543

Query: 724 KCGGVGLNLIGGNTL 768
           +  GVG+ L   +T+
Sbjct: 544 RAAGVGITLTAASTV 558


>At1g79680.1 68414.m09293 wall-associated kinase, putative similar
           to wall-associated kinase 2 GI:4826399 from [Arabidopsis
           thaliana]
          Length = 769

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -1

Query: 441 LPCMAKYGWQQICLNFSISHNTCC 370
           L C A+YG  + C N SI ++T C
Sbjct: 168 LYCNARYGDSEYCKNISIMNDTSC 191


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,916,115
Number of Sequences: 28952
Number of extensions: 346840
Number of successful extensions: 1114
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1011
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1107
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1775300800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -