SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g49750.1 68414.m05579 leucine-rich repeat family protein cont...    31   1.0  
At4g12310.1 68417.m01949 cytochrome P450, putative similar to P4...    30   1.4  
At3g50370.1 68416.m05508 expressed protein                             30   1.8  
At2g32300.1 68415.m03949 uclacyanin I identical to uclacyanin I ...    30   1.8  
At3g09430.1 68416.m01120 hypothetical protein                          29   2.4  
At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex...    25   2.8  
At3g12980.1 68416.m01617 histone acetyltransferase 5 (HAC5) iden...    29   3.2  
At3g04160.1 68416.m00440 expressed protein ; expression supporte...    29   3.2  
At5g26810.1 68418.m03199 pectinesterase family protein contains ...    29   4.2  
At5g09370.2 68418.m01086 protease inhibitor/seed storage/lipid t...    29   4.2  
At5g09370.1 68418.m01085 protease inhibitor/seed storage/lipid t...    29   4.2  
At2g43150.1 68415.m05358 proline-rich extensin-like family prote...    29   4.2  
At1g43850.1 68414.m05052 SEUSS transcriptional co-regulator iden...    29   4.2  
At1g25540.1 68414.m03171 phytochrome and flowering time regulato...    29   4.2  
At1g06670.1 68414.m00707 DEIH-box RNA/DNA helicase identical to ...    29   4.2  
At5g06630.1 68418.m00749 proline-rich extensin-like family prote...    28   5.6  
At3g54590.1 68416.m06040 proline-rich extensin-like family prote...    28   5.6  
At3g54580.1 68416.m06039 proline-rich extensin-like family prote...    28   5.6  
At3g30530.1 68416.m03864 bZIP transcription factor family protei...    28   5.6  
At3g12410.1 68416.m01546 hypothetical protein                          28   5.6  
At2g24980.1 68415.m02987 proline-rich extensin-like family prote...    28   5.6  
At1g76930.2 68414.m08956 proline-rich extensin-like family prote...    28   5.6  
At1g76930.1 68414.m08955 proline-rich extensin-like family prote...    28   5.6  
At2g34470.1 68415.m04231 urease accessory protein (UREG) identic...    28   7.3  
At1g21310.1 68414.m02662 proline-rich extensin-like family prote...    28   7.3  
At5g55020.1 68418.m06853 myb family transcription factor (MYB120...    27   9.7  
At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co...    27   9.7  
At4g16680.1 68417.m02519 RNA helicase, putative similar to SP|Q1...    27   9.7  
At2g40820.1 68415.m05038 proline-rich family protein contains pr...    27   9.7  
At1g07310.1 68414.m00778 C2 domain-containing protein contains s...    27   9.7  

>At1g49750.1 68414.m05579 leucine-rich repeat family protein
           contains leucine-rich repeats, Pfam:PF00560
          Length = 494

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = -1

Query: 656 ECCTSPIPPPCTGRPS*VVCPPRP 585
           +C   P PPPC   PS   CPP P
Sbjct: 60  DCPPPPPPPPCPPPPSPPPCPPPP 83


>At4g12310.1 68417.m01949 cytochrome P450, putative similar to P450
           monooxygenase GI:14334057 from [Gossypium arboreum ]
          Length = 383

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 1/127 (0%)
 Frame = +3

Query: 189 DRTVQQEQRTDARRRRIYLVQQCVDFVQKIIRYYRCNDMSELSPLMIHFINTIRDMCIDT 368
           DR ++Q QR    R R     +C DF+Q +++       S++   M H    + DM +  
Sbjct: 126 DRAIEQMQRL---RSRDGDDGECKDFLQHLMKLRDQEADSDVPITMNHVKAVLMDMVVGG 182

Query: 369 NPINVNVVKRFESEETMIRHLI-RLQKELGQGNAAESLPSDSNIFQASLC*IRCRRTRKN 545
              + N ++   +E      L+ R Q+EL +    +++  +S+I          + T + 
Sbjct: 183 TESSTNTIEFVMAELISNPELMRRAQQELDEVVGKDNIVEESHITSLPYILAVLKETLRL 242

Query: 546 FTTVALI 566
           + T+ L+
Sbjct: 243 YPTIPLL 249


>At3g50370.1 68416.m05508 expressed protein
          Length = 2179

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +1

Query: 40   PPPPLRYPSNPAT----AIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS 183
            PPPP RYP+  A+    A+  ++  Y++  G  PP    + +    SN+T +
Sbjct: 2037 PPPPNRYPNVQASTVVDAMVDSSNAYSSTTG-APPAKPTSTLSDPNSNNTQN 2087


>At2g32300.1 68415.m03949 uclacyanin I identical to uclacyanin I
           GI:3399767 from [Arabidopsis thaliana]; contains Pfam
           profile PF02298: Plastocyanin-like domain; identical to
           cDNA uclacyanin I GI:3399766
          Length = 261

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +1

Query: 46  PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVA 189
           PPL    +PATA  T+   +  +PG    TT    + T  S++T + A
Sbjct: 180 PPLSPALSPATAAGTSLPLFPGSPGSSSSTTSTKTVGTFPSSTTGTTA 227


>At3g09430.1 68416.m01120 hypothetical protein
          Length = 247

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSR 165
           YN+PP P+ YPS  +  +    +  N   G    + R +KM  SR
Sbjct: 53  YNSPPTPVSYPSPQSKILQIPNRNPNLGRGLNEESNRPSKMARSR 97


>At4g18670.1 68417.m02762 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 839

 Score = 25.0 bits (52), Expect(2) = 2.8
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = +1

Query: 25  FYYNTPPPP 51
           +YYN+PPPP
Sbjct: 786 YYYNSPPPP 794



 Score = 22.6 bits (46), Expect(2) = 2.8
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNP 72
           +Y+ PPPP+ + S P
Sbjct: 798 HYSPPPPPVIHHSQP 812


>At3g12980.1 68416.m01617 histone acetyltransferase 5 (HAC5)
           identical to HAC5 (GI:21105780) [Arabidopsis thaliana];
           similar to CREB-binding protein GB:S39162 from [Homo
           sapiens]
          Length = 1670

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 14/44 (31%), Positives = 27/44 (61%)
 Frame = +1

Query: 64  SNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIA 195
           +NP++++ T  QT   + G+    T    +DTS+ NS+N+++ A
Sbjct: 115 ANPSSSVSTMVQTPGVSHGWGQSYTATPMVDTSKFNSSNNLSDA 158


>At3g04160.1 68416.m00440 expressed protein ; expression supported
          by MPSS
          Length = 712

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 9/16 (56%), Positives = 13/16 (81%)
 Frame = +1

Query: 22 NFYYNTPPPPLRYPSN 69
          NF++  PPPPL+ P+N
Sbjct: 29 NFFFRPPPPPLQNPNN 44


>At5g26810.1 68418.m03199 pectinesterase family protein contains
           Pfam profile: PF01095 pectinesterase
          Length = 293

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = -2

Query: 655 NVARHRFRHHVLDGQAELFARLGQSVFTQ-HISAT 554
           N+ RH F++  ++G  +     GQSV+   HI+AT
Sbjct: 128 NLGRHHFKNCYIEGAIDFIFGSGQSVYEDCHINAT 162


>At5g09370.2 68418.m01086 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to lipid
           transfer protein - Hordeum vulgare, EMBL:AF109195;
           contains Pfam protease inhibitor/seed storage/LTP family
           domain PF00234
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = -3

Query: 651 LHVTDSATMYWTAKLSCLPASAKASLPNISAP 556
           L+VT SAT+    KL+  P SA  SLP  S P
Sbjct: 83  LNVTKSATLPVACKLNAPPVSACDSLPPASPP 114


>At5g09370.1 68418.m01085 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to lipid
           transfer protein - Hordeum vulgare, EMBL:AF109195;
           contains Pfam protease inhibitor/seed storage/LTP family
           domain PF00234
          Length = 158

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = -3

Query: 651 LHVTDSATMYWTAKLSCLPASAKASLPNISAP 556
           L+VT SAT+    KL+  P SA  SLP  S P
Sbjct: 83  LNVTKSATLPVACKLNAPPVSACDSLPPASPP 114


>At2g43150.1 68415.m05358 proline-rich extensin-like family
          protein similar to CRANTZ hydroxyproline-rich
          glycoprotein [Manihot esculenta]
          gi|7211797|gb|AAF40442; similar to extensin
          gi|1165322|gb|AAB53156; contains proline-rich extensin
          domains, INTERPRO:IPR002965
          Length = 212

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +1

Query: 25 FYYNTPPPPLRYPSNP 72
          +YY++PPPP  Y S P
Sbjct: 31 YYYSSPPPPYEYKSPP 46



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNP 72
           +YY++PPPP++ P  P
Sbjct: 72  YYYHSPPPPVKSPPPP 87



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNP 72
           +YY++PPPP++ P  P
Sbjct: 104 YYYHSPPPPVKSPPPP 119



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNP 72
           +YY++PPPP++ P  P
Sbjct: 120 YYYHSPPPPVKSPPPP 135



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNP 72
           +YY++PPPP++ P  P
Sbjct: 136 YYYHSPPPPVKSPPPP 151



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNP 72
           +YY++PPPP++ P  P
Sbjct: 152 YYYHSPPPPVKSPPPP 167



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNP 72
           +YY++PPPP++ P  P
Sbjct: 168 YYYHSPPPPVKSPPPP 183


>At1g43850.1 68414.m05052 SEUSS transcriptional co-regulator
           identical to SEUSS transcriptional co-regulator
           [Arabidopsis thaliana] gi|18033922|gb|AAL57277
          Length = 877

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 7/63 (11%)
 Frame = +1

Query: 1   SMTDERGNFYYNTPPPP-------LRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDT 159
           SM     N  YN P  P       ++ PS+  T + +++Q  +N P +  PT+  N  + 
Sbjct: 663 SMKGRHQNAAYNPPNSPYGGNSVQMQSPSSSGTMVPSSSQQQHNLPTFQSPTSSSNNNNP 722

Query: 160 SRS 168
           S++
Sbjct: 723 SQN 725


>At1g25540.1 68414.m03171 phytochrome and flowering time regulatory
           protein (PFT1) PMID: 12815435
          Length = 836

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFV 269
           Q+ +LQQ+ ++      +QQ+  + QQQH+L   +  QQ+Q+   ++++ + + Q     
Sbjct: 705 QQQHLQQQ-QMPQLQQQQQQHQQQQQQQHQLSQLQHHQQQQQQQQQQQQQHQLTQLQHHH 763

Query: 270 QKIIRYYRCNDM-SELSPL 323
           Q+  +    N M  + SPL
Sbjct: 764 QQQQQASPLNQMQQQTSPL 782


>At1g06670.1 68414.m00707 DEIH-box RNA/DNA helicase identical to
            DEIH-box RNA/DNA helicase GB:BAA84364 GI:5881579
            [Arabidopsis thaliana]
          Length = 1576

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 348  RDMCIDTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAESLPSD 488
            RD    TNP   N ++  +   T +   + L  +LG GN  ESLPS+
Sbjct: 1141 RDDIPSTNP---NELREHDPNTTPMGSKLELANKLGLGNMEESLPSN 1184


>At5g06630.1 68418.m00749 proline-rich extensin-like family protein
           contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 440

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 100 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 129



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 125 YYKSPPPPYVYSSPPPLYYSPSPKVYYKSP 154



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 150 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 179



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 175 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 204



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 200 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 229



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 225 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 254



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 250 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 279



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 275 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 304



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 300 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 329



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +1

Query: 22  NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           N YY +PPPP  Y S P      + + +  +P
Sbjct: 348 NVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSP 379



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      +   Y  +P
Sbjct: 325 YYKSPPPPYVYSSPPPPYYSPSPNVYYKSP 354


>At3g54590.1 68416.m06040 proline-rich extensin-like family protein
           contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 743

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 417 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 446



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 442 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 471



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 467 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 496



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 492 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 521



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 592 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 621



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 617 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 646


>At3g54580.1 68416.m06039 proline-rich extensin-like family protein
           contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 951

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 492 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 521



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 517 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 546



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 558 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 587



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 633 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 662



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 658 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 687



 Score = 27.5 bits (58), Expect = 9.7
 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNA--PGYVPPTTR 141
           YY +PPPP  Y S P      + + +  +  P Y  PT +
Sbjct: 734 YYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPK 773


>At3g30530.1 68416.m03864 bZIP transcription factor family protein
           similar to bZIP protein(G/HBF-1) GI:1905785 from
           [Glycine max ]; contains PFAM profile: bZIP
           transcription factor PF00170
          Length = 173

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSN-PATAIF-TNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVA 189
           Y N+      YPSN P +  F TN Q      G+  PT     M  S +NST+  A
Sbjct: 13  YLNSSILQSPYPSNFPISTPFPTNGQNPYLLYGFQSPTNNPQSMSLSSNNSTSDEA 68


>At3g12410.1 68416.m01546 hypothetical protein
          Length = 230

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 12/23 (52%), Positives = 13/23 (56%)
 Frame = +1

Query: 7   TDERGNFYYNTPPPPLRYPSNPA 75
           +D R N YY  PPP   Y  NPA
Sbjct: 71  SDPRPNNYYADPPPIRYYSDNPA 93


>At2g24980.1 68415.m02987 proline-rich extensin-like family protein
           contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 559

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 194 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 223



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 219 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 248



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 244 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 273



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 269 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 298



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 294 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 323



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 319 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 348



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 344 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 373



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 369 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 398



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 419 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 448



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 444 YYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 473



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           YY +PPPP  Y S P      + + Y  +P
Sbjct: 394 YYKSPPPPYVYNSPPPPYYSPSPKVYYKSP 423


>At1g76930.2 68414.m08956 proline-rich extensin-like family
          protein contains extensin-like region, Pfam:PF04554
          Length = 256

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 8/17 (47%), Positives = 15/17 (88%)
 Frame = +1

Query: 22 NFYYNTPPPPLRYPSNP 72
          N++Y++PPPP+++ S P
Sbjct: 24 NYFYSSPPPPVKHYSPP 40


>At1g76930.1 68414.m08955 proline-rich extensin-like family
          protein contains extensin-like region, Pfam:PF04554
          Length = 293

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 8/17 (47%), Positives = 15/17 (88%)
 Frame = +1

Query: 22 NFYYNTPPPPLRYPSNP 72
          N++Y++PPPP+++ S P
Sbjct: 24 NYFYSSPPPPVKHYSPP 40


>At2g34470.1 68415.m04231 urease accessory protein (UREG) identical
           to urease accessory protein UREG GI:4324678 from
           [Arabidopsis thaliana]; contains Pfam profile: PF01495
           HypB/UreG nucleotide-binding domain
          Length = 275

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +2

Query: 317 SSHDSFYKHYS*HVHRHEPDQRKRGKAV*IGGD 415
           +SHD  + H+  H H HE      GKA  +G D
Sbjct: 2   ASHDHHHHHHD-HEHDHEKSDGGEGKASWVGKD 33


>At1g21310.1 68414.m02662 proline-rich extensin-like family protein
           contains extensin-like region, Pfam:PF04554
          Length = 431

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 9/38 (23%), Positives = 22/38 (57%)
 Frame = +1

Query: 4   MTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAP 117
           ++    N++Y++PPPP+++   P    ++    Y++ P
Sbjct: 22  VSQSTANYFYSSPPPPVKH-YTPPVKHYSPPPVYHSPP 58


>At5g55020.1 68418.m06853 myb family transcription factor (MYB120)
           contains Pfam profile: PF00249 myb-like DNA-binding
           domain
          Length = 523

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +1

Query: 10  DERGNFYYNTPPPPLRYPSNPATAIFTNAQT 102
           +  GNF +  PPP L+ PS+     + NA T
Sbjct: 267 NNNGNFTFPRPPPLLQPPSSLFAKRYNNANT 297


>At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG)
           contains seven G-protein beta WD-40 repeats; beta
           transducin-like protein, Podospora anserina, gb:L28125;
           contains Pfam profiles PF04503:  Single-stranded DNA
           binding protein, SSDP; PF00400:WD domain, G-beta repeat;
           identical to cDNA LEUNIG (LEUNIG) GI:11141604
          Length = 931

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/61 (26%), Positives = 28/61 (45%)
 Frame = +3

Query: 33  QHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQ 212
           QHP  + +         I  +  L QRA+ +     +Q + H+ QQQ +    +  QQ+Q
Sbjct: 95  QHPQVSQQQQQ-QQQQQIQMQQLLLQRAQQQQQQQQQQHHHHQQQQQQQQQQQQQQQQQQ 153

Query: 213 R 215
           +
Sbjct: 154 Q 154


>At4g16680.1 68417.m02519 RNA helicase, putative similar to
           SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase
           HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam
           profiles PF04408: Helicase associated domain (HA2),
           PF00271: Helicase conserved C-terminal domain
          Length = 883

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 7/26 (26%), Positives = 17/26 (65%)
 Frame = +2

Query: 599 KQLSLAVQYMVAESVTCNIPIPLPFN 676
           ++++  +Q++  E  TC +P+ + FN
Sbjct: 15  EEMNSTIQFLSVEKTTCRLPVSIKFN 40


>At2g40820.1 68415.m05038 proline-rich family protein contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 903

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/53 (28%), Positives = 23/53 (43%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPY 201
           PPP++ P  P  + +         P Y+P +  D+ M     N+TN     PY
Sbjct: 761 PPPMQPPPPPMNSGYM--------PTYIPKSVNDSSMPNPPMNNTNPQMQQPY 805


>At1g07310.1 68414.m00778 C2 domain-containing protein contains
           similarity to shock protein SRC2 [Glycine max]
           gi|2055230|dbj|BAA19769 ; contains Pfam profile
           PF00168:C2 domain
          Length = 352

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = +1

Query: 16  RGNFYYNTPPPPLRYPSNPATA 81
           +GN YY+  PPP   P  P TA
Sbjct: 162 QGNHYYSPSPPPPPPPQAPITA 183


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,658,411
Number of Sequences: 28952
Number of extensions: 342046
Number of successful extensions: 2134
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 1274
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2086
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1604469728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -