SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g48770.1 68414.m05458 hypothetical protein                          31   0.93 
At1g26170.1 68414.m03194 importin beta-2 subunit family protein ...    29   2.1  
At2g29680.2 68415.m03608 cell division control protein CDC6, put...    29   2.8  
At2g29680.1 68415.m03607 cell division control protein CDC6, put...    29   2.8  
At2g21480.1 68415.m02556 protein kinase family protein contains ...    28   4.9  
At1g30650.1 68414.m03748 WRKY family transcription factor contai...    28   4.9  
At3g23480.1 68416.m02958 cyclopropane fatty acid synthase-relate...    28   6.5  
At3g23470.1 68416.m02957 cyclopropane-fatty-acyl-phospholipid sy...    28   6.5  
At2g04305.1 68415.m00423 magnesium transporter CorA-like protein...    28   6.5  
At1g35920.1 68414.m04461 hypothetical protein includes At5g34960...    28   6.5  
At1g51170.1 68414.m05754 protein kinase family protein                 27   8.6  

>At1g48770.1 68414.m05458 hypothetical protein
          Length = 179

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +1

Query: 349 QPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           +PP ER + L +F LPQ   G +RF+  VN
Sbjct: 2   EPPFERSKRLHNFSLPQLRWGQQRFLRCVN 31


>At1g26170.1 68414.m03194 importin beta-2 subunit family protein
           similar to Importin9 isoform 1 [Mus musculus]
           GI:15186756; contains Pfam profile PF03810:
           Importin-beta N-terminal domain
          Length = 931

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = +2

Query: 140 SKIYRRSYDFCFAYVDDILVYSRD--ALQHAAHLRTLF 247
           S I + +YDFCFA V  I+++S D   LQ+A      F
Sbjct: 593 SDIVKTAYDFCFAAVIRIVLHSEDHGELQNATECLAAF 630


>At2g29680.2 68415.m03608 cell division control protein CDC6,
           putative almost identical to DNA replication protein
           CDC6 GI:18056480 from [Arabidopsis thaliana];  identical
           to cDNA CDC6 protein (2g29680 gene) GI:18056479
          Length = 508

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +3

Query: 51  DICKTAIITPFGLYEFNYMTFGLRNAG 131
           +ICK+++ITP G+ EF+ M   L + G
Sbjct: 443 EICKSSMITPAGITEFSNMCTVLNDQG 469


>At2g29680.1 68415.m03607 cell division control protein CDC6,
           putative almost identical to DNA replication protein
           CDC6 GI:18056480 from [Arabidopsis thaliana];  identical
           to cDNA CDC6 protein (2g29680 gene) GI:18056479
          Length = 539

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +3

Query: 51  DICKTAIITPFGLYEFNYMTFGLRNAG 131
           +ICK+++ITP G+ EF+ M   L + G
Sbjct: 474 EICKSSMITPAGITEFSNMCTVLNDQG 500


>At2g21480.1 68415.m02556 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 871

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +3

Query: 510 GKGLTPITWTPELEECFNACK 572
           GK L+P+TW   LE C  A +
Sbjct: 612 GKNLSPLTWKQRLEICIGAAR 632


>At1g30650.1 68414.m03748 WRKY family transcription factor contains
           Pfam profile: PF03106 WRKY DNA -binding domain
          Length = 430

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = -3

Query: 451 IGDNN*PSQ*NDGVLVQSVVEENLLELECAL 359
           +GDNN     N+G LV  V EE+ ++ +C++
Sbjct: 85  VGDNNNNIHNNNGFLVPKVFEEDHIKSQCSI 115


>At3g23480.1 68416.m02958 cyclopropane fatty acid synthase-related
           similar to cyclopropane synthase [Sterculia foetida]
           GI:21069167
          Length = 513

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 119 TQRRPNVSKIYRRSYDFCFAYVDDILVYS 205
           TQ R NVS  Y  S +F   ++DD ++YS
Sbjct: 161 TQARRNVSSHYDLSNEFFGLFMDDTMMYS 189


>At3g23470.1 68416.m02957 cyclopropane-fatty-acyl-phospholipid
           synthase family protein similar to cyclopropane synthase
           [Sterculia foetida] GI:21069167; contains Pfam profile
           PF02353: Cyclopropane-fatty-acyl-phospholipid synthase
          Length = 406

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 119 TQRRPNVSKIYRRSYDFCFAYVDDILVYS 205
           TQ R N+S  Y  S +F   ++DD ++YS
Sbjct: 107 TQARKNISSHYDLSNEFFGLFMDDTMMYS 135


>At2g04305.1 68415.m00423 magnesium transporter CorA-like
           protein-related
          Length = 434

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 17/58 (29%), Positives = 31/58 (53%)
 Frame = +1

Query: 1   VPSTSLRHISKFLLRLRISVKPPS*HPSDSTNLIT*LLVYATQAKRFKDL*TKLRFLL 174
           VPS    H+ +FLL++  S +  +  P+  +NL+  + +  T   R +D+ T+L   L
Sbjct: 169 VPSVIEEHVLEFLLKMNHSEEADNPVPTSVSNLV--VHIIDTHVDRLQDVVTELEIEL 224


>At1g35920.1 68414.m04461 hypothetical protein includes At5g34960,
           At2g14450, At1g35920
          Length = 567

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGN-RISADGTQPPSERIQA 375
           Q +ED    +NPA  V G   +  L N   S D T P S+R+ A
Sbjct: 427 QLLEDSAEHVNPASIVSGDQVLLMLENGNGSPDSTTPSSKRVYA 470


>At1g51170.1 68414.m05754 protein kinase family protein
          Length = 404

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
 Frame = -3

Query: 514 LPQWPRSR*LAVLVTW--PHCAEIGDNN*PSQ*-NDGVLVQSVVEENLLELECAL 359
           LP+   S   +  + W  P+C+  GD N   Q  NDGV   SV++  L E+ CAL
Sbjct: 88  LPKLLASSESSEFIAWALPYCSG-GDLNVLRQRQNDGVFSSSVIKFYLAEIVCAL 141


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,789,027
Number of Sequences: 28952
Number of extensions: 270987
Number of successful extensions: 704
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 691
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 704
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1428369392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -