SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g17910.1 68417.m02669 zinc finger (C3HC4-type RING finger) fa...    36   0.020
At4g33565.1 68417.m04770 zinc finger (C3HC4-type RING finger) fa...    36   0.036
At4g15975.1 68417.m02425 zinc finger (C3HC4-type RING finger) fa...    35   0.047
At1g72200.1 68414.m08348 zinc finger (C3HC4-type RING finger) fa...    35   0.047
At5g17600.1 68418.m02064 zinc finger (C3HC4-type RING finger) fa...    35   0.062
At4g10160.1 68417.m01662 zinc finger (C3HC4-type RING finger) fa...    34   0.11 
At3g05200.1 68416.m00567 zinc finger (C3HC4-type RING finger) fa...    34   0.11 
At3g03550.1 68416.m00357 zinc finger (C3HC4-type RING finger) fa...    34   0.11 
At1g72220.1 68414.m08350 zinc finger (C3HC4-type RING finger) fa...    34   0.11 
At5g37270.1 68418.m04477 zinc finger (C3HC4-type RING finger) fa...    33   0.14 
At5g37250.1 68418.m04475 zinc finger (C3HC4-type RING finger) fa...    33   0.19 
At5g37230.1 68418.m04472 zinc finger (C3HC4-type RING finger) fa...    33   0.19 
At5g42200.1 68418.m05136 zinc finger (C3HC4-type RING finger) fa...    33   0.25 
At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger) fa...    33   0.25 
At2g35000.1 68415.m04294 zinc finger (C3HC4-type RING finger) fa...    32   0.33 
At1g22500.1 68414.m02811 zinc finger (C3HC4-type RING finger) fa...    32   0.44 
At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) fa...    31   0.58 
At4g10150.1 68417.m01660 zinc finger (C3HC4-type RING finger) fa...    31   0.58 
At3g16720.1 68416.m02135 zinc finger (C3HC4-type RING finger) fa...    31   0.58 
At1g33480.1 68414.m04144 zinc finger (C3HC4-type RING finger) fa...    31   0.58 
At3g62690.1 68416.m07042 zinc finger (C3HC4-type RING finger) fa...    31   0.77 
At5g66070.1 68418.m08324 zinc finger (C3HC4-type RING finger) fa...    31   1.0  
At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger) fa...    31   1.0  
At5g41430.1 68418.m05032 zinc finger (C3HC4-type RING finger) fa...    31   1.0  
At2g20030.1 68415.m02341 zinc finger (C3HC4-type RING finger) fa...    31   1.0  
At2g17450.1 68415.m02014 zinc finger (C3HC4-type RING finger) fa...    31   1.0  
At3g60300.1 68416.m06740 RWD domain-containing protein contains ...    30   1.3  
At4g28370.1 68417.m04061 zinc finger (C3HC4-type RING finger) fa...    30   1.8  
At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) fa...    30   1.8  
At2g29840.1 68415.m03624 zinc finger (C3HC4-type RING finger) fa...    30   1.8  
At1g28040.1 68414.m03433 zinc finger (C3HC4-type RING finger) fa...    30   1.8  
At1g18780.1 68414.m02341 zinc finger (C3HC4-type RING finger) fa...    30   1.8  
At5g20885.1 68418.m02480 zinc finger (C3HC4-type RING finger) fa...    29   2.3  
At5g06490.1 68418.m00728 zinc finger (C3HC4-type RING finger) fa...    29   2.3  
At2g47560.1 68415.m05935 zinc finger (C3HC4-type RING finger) fa...    29   2.3  
At2g42350.1 68415.m05241 zinc finger (C3HC4-type RING finger) fa...    29   2.3  
At1g49230.1 68414.m05519 zinc finger (C3HC4-type RING finger) fa...    29   2.3  
At1g26800.1 68414.m03266 zinc finger (C3HC4-type RING finger) fa...    29   2.3  
At5g01880.1 68418.m00107 zinc finger (C3HC4-type RING finger) fa...    29   3.1  
At3g58720.1 68416.m06545 zinc finger (C3HC4-type RING finger) fa...    29   3.1  
At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) fa...    29   3.1  
At5g02750.1 68418.m00217 zinc finger (C3HC4-type RING finger) fa...    29   4.1  
At4g24015.1 68417.m03451 zinc finger (RING-H2 type) protein-rela...    29   4.1  
At4g02075.1 68417.m00278 zinc finger (C3HC4-type RING finger) fa...    29   4.1  
At3g14320.1 68416.m01811 zinc finger (C3HC4-type RING finger) fa...    29   4.1  
At2g25410.1 68415.m03043 hypothetical protein                          29   4.1  
At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c...    29   4.1  
At5g43200.1 68418.m05278 zinc finger (C3HC4-type RING finger) fa...    28   5.4  
At2g15740.1 68415.m01802 zinc finger (C2H2 type) family protein ...    28   5.4  
At1g21370.2 68414.m02674 expressed protein                             28   5.4  
At1g21370.1 68414.m02673 expressed protein                             28   5.4  
At1g20823.1 68414.m02608 zinc finger (C3HC4-type RING finger) fa...    28   5.4  
At5g38070.1 68418.m04587 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At5g37280.1 68418.m04478 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At4g23030.1 68417.m03321 MATE efflux protein-related contains Pf...    28   7.2  
At4g09130.1 68417.m01507 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At3g02800.1 68416.m00272 tyrosine specific protein phosphatase f...    28   7.2  
At2g37580.1 68415.m04610 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At2g20650.2 68415.m02422 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At2g20650.1 68415.m02421 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At1g76410.1 68414.m08881 zinc finger (C3HC4-type RING finger) fa...    28   7.2  
At5g55970.2 68418.m06981 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At5g55970.1 68418.m06980 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At5g05530.1 68418.m00600 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At4g09120.1 68417.m01505 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At3g18930.2 68416.m02403 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At3g18930.1 68416.m02402 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At2g17730.1 68415.m02054 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At2g01760.1 68415.m00106 two-component responsive regulator fami...    27   9.5  
At1g72310.1 68414.m08359 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At1g61780.1 68414.m06967 postsynaptic protein-related similar to...    27   9.5  
At1g57570.1 68414.m06533 jacalin lectin family protein similar t...    27   9.5  
At1g53820.1 68414.m06126 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At1g49850.1 68414.m05589 zinc finger (C3HC4-type RING finger) fa...    27   9.5  

>At4g17910.1 68417.m02669 zinc finger (C3HC4-type RING finger) family
            protein / pentatricopeptide (PPR) repeat-containing
            protein contains Pfam domains PF01535: PPR repeat and
            PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 1208

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 18/71 (25%), Positives = 33/71 (46%)
 Frame = +3

Query: 21   LKDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWR 200
            +K   ++  K  ++ +    T+C ICL + +++  +  +P          FH  CI RW 
Sbjct: 1031 IKKIGFFKLKKHQNGFKINGTDCSICLGEFNEDESLRLLP-----KCNHTFHVVCIDRWL 1085

Query: 201  REHTRDPFNRA 233
            + H+  P  RA
Sbjct: 1086 KSHSNCPLCRA 1096


>At4g33565.1 68417.m04770 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 204

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T+C +CL + ++   +  +P       +  FH  CI  W R HT  P  RA
Sbjct: 52  TDCSVCLSEFEEEETLRLLP-----KCKHAFHLYCIDTWLRSHTNCPLCRA 97


>At4g15975.1 68417.m02425 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 235

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 17/50 (34%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL +  DN     MP     N +  FH  CI  W   H+  P  R+
Sbjct: 75  ECSVCLSEFKDNESGRVMP-----NCKHTFHVHCIDMWFHSHSSCPLCRS 119


>At1g72200.1 68414.m08348 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 404

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +D+  +  +P         +FH  CI  W R HT  P  RA
Sbjct: 143 ECSVCLNEFEDDETLRLIPKCC-----HVFHPGCIDAWLRSHTTCPLCRA 187


>At5g17600.1 68418.m02064 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 362

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 16/59 (27%), Positives = 26/59 (44%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFP 257
           ++C +CL + ++N  +  +P          FH  CI  W + H+  P  RA     N P
Sbjct: 140 SDCSVCLSEFEENESLRLLP-----KCNHAFHLPCIDTWLKSHSNCPLCRAFVTGVNNP 193


>At4g10160.1 68417.m01662 zinc finger (C3HC4-type RING finger)
           family protein zinc finger protein, Arabidopsis
           thaliana, gb:L76926
          Length = 225

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 17/60 (28%), Positives = 25/60 (41%)
 Frame = +3

Query: 51  LFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           ++K+ +    T+C +CL        +  MP  G       FH +CI  W   HT  P  R
Sbjct: 85  IYKESFTVNDTQCSVCLGDYQAEEKLQQMPSCG-----HTFHMECIDLWLTSHTTCPLCR 139


>At3g05200.1 68416.m00567 zinc finger (C3HC4-type RING finger)
           family protein (ATL6) contains Pfam profile: PF00097:
           Zinc finger, C3HC4 type (RING finger)
          Length = 398

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 16/50 (32%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC ICL + +D+  +  +P       + +FH  CI  W   H   P  RA
Sbjct: 127 ECAICLNEFEDDETLRLLP-----KCDHVFHPHCIDAWLEAHVTCPVCRA 171


>At3g03550.1 68416.m00357 zinc finger (C3HC4-type RING finger)
           family protein contains zinc finger domain, C3HC4 type
           (RING finger) 152633.
          Length = 356

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 14/52 (26%), Positives = 24/52 (46%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +++C +CL +  +N  +  +P          FH  CI  W + H+  P  RA
Sbjct: 156 SSDCSVCLSEFQENESLRLLP-----KCNHAFHVPCIDTWLKSHSNCPLCRA 202


>At1g72220.1 68414.m08350 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger); similar to GI:4928397
           from [Arabidopsis thaliana] (Plant Mol. Biol. 40 (4),
           579-590 (1999))
          Length = 413

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 15/51 (29%), Positives = 23/51 (45%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T+C +CL + +++  +  +P          FH  CI  W   HT  P  RA
Sbjct: 175 TDCPVCLNEFEEDESLRLLP-----KCNHAFHISCIDTWLSSHTNCPLCRA 220


>At5g37270.1 68418.m04477 zinc finger (C3HC4-type RING finger)
           family protein ow similarity to RING-H2 finger protein
           RHA3b [gi:3790575], RHA1a [gi:3790554]; contains Pfam
           domain zinc finger, C3HC4 type (RING finger) PF00097
          Length = 208

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 2/65 (3%)
 Frame = +3

Query: 54  FKDYWPTCTTECQICLEKIDDN--GGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFN 227
           F D      T C ICLE   ++    I+ +PD   L     FH+ CI  W +     P  
Sbjct: 142 FTDLGDEEETTCSICLEDFSESHDDNIILLPDCFHL-----FHQSCIFEWLKRQRSCPLC 196

Query: 228 RAIKY 242
           R + Y
Sbjct: 197 RRVPY 201


>At5g37250.1 68418.m04475 zinc finger (C3HC4-type RING finger)
           family protein low similarity to RING-H2 finger protein
           RHA3b [gi:3790575], RHA3a [gi:3790573]; contains Pfam
           domain zinc finger, C3HC4 type (RING finger) PF00097
          Length = 192

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 81  TECQICLEKIDDN--GGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKY 242
           T C ICLE   ++    I+ +PD   L     FH+ CI  W +     P  R + Y
Sbjct: 135 TTCSICLEDFSESHDDNIILLPDCFHL-----FHQNCIFEWLKRQRSCPLCRRVPY 185


>At5g37230.1 68418.m04472 zinc finger (C3HC4-type RING finger)
           family protein low similarity to RING-H2 finger protein
           RHA3b, Arabidopsis thaliana, PIR:T41745 [gi:3790575];
           contains Pfam domain zinc finger, C3HC4 type (RING
           finger) PF00097
          Length = 208

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +3

Query: 81  TECQICLEKIDDN--GGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKY 242
           T C IC+E   ++    I+ +PD   L     FH+ CI +W +     P  R + Y
Sbjct: 151 TTCSICMEDFSESHDDNIILLPDCFHL-----FHQSCIFKWLKRQRSCPLCRRVPY 201


>At5g42200.1 68418.m05136 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 163

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 20/61 (32%), Positives = 26/61 (42%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFP 257
           +TEC +CLE I+       +P          FH+ C   W   HT  P  RA +   N P
Sbjct: 101 STECAVCLEDIESGQSTRLVP-----GCNHGFHQLCADTWLSNHTVCPVCRA-ELAPNLP 154

Query: 258 Q 260
           Q
Sbjct: 155 Q 155


>At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 301

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 15/51 (29%), Positives = 22/51 (43%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TEC +CL + +++  +  +P          FH  CI  W   H   P  RA
Sbjct: 133 TECSVCLNEFEEDESLRLLP-----KCSHAFHLNCIDTWLLSHKNCPLCRA 178


>At2g35000.1 68415.m04294 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 378

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +D+  +  MP         +FH  C+  W  EH+  P  RA
Sbjct: 134 ECAVCLCEFEDDETLRLMPPCC-----HVFHADCVDVWLSEHSTCPLCRA 178


>At1g22500.1 68414.m02811 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 381

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 16/50 (32%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +D+  +  +P         +FH  CI  W R  T  P  RA
Sbjct: 117 ECPVCLNEFEDDETLRLIPQCC-----HVFHPGCIDAWLRSQTTCPLCRA 161


>At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger)
           family protein similar to RING-H2 zinc finger protein
           ATL6 [Arabidopsis thaliana]
           gi|4928403|gb|AAD33584.1|AF132016_1[4928403]; contains
           Pfam domain, PF00097: Zinc finger, C3HC4 type (RING
           finger)
          Length = 368

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC ICL + +D+  +  +P       + +FH  CI  W + H   P  R
Sbjct: 123 ECAICLNEFEDDETLRLLP-----KCDHVFHPHCIGAWLQGHVTCPVCR 166


>At4g10150.1 68417.m01660 zinc finger (C3HC4-type RING finger)
           family protein RING-H2 finger protein RHA1a, Arabidopsis
           thaliana,AF078683
          Length = 236

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 16/60 (26%), Positives = 25/60 (41%)
 Frame = +3

Query: 51  LFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           ++K+ +    ++C +CL        +  MP  G       FH +CI  W   HT  P  R
Sbjct: 99  IYKESFIVKDSQCSVCLGDYQAEEKLQQMPSCG-----HTFHMECIDLWLTSHTTCPLCR 153


>At3g16720.1 68416.m02135 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 304

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 14/51 (27%), Positives = 24/51 (47%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           EC +CL + +++     +P     N +  FH  CI  W   H+  P  R++
Sbjct: 118 ECAVCLSEFEESETGRVLP-----NCQHTFHVDCIDMWFHSHSTCPLCRSL 163


>At1g33480.1 68414.m04144 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 508

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 16/60 (26%), Positives = 25/60 (41%)
 Frame = +3

Query: 51  LFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +FK+ +    ++C +CL     N  +  +P       +  FH  CI  W   HT  P  R
Sbjct: 88  VFKESFTVMDSQCSVCLGDYQPNDKLQQIPVC-----KHTFHMDCIDLWLTSHTTCPLCR 142


>At3g62690.1 68416.m07042 zinc finger (C3HC4-type RING finger)
           family protein (ATL5) identical to RING-H2 zinc finger
           protein ATL5 [Arabidopsis thaliana]
           gi|4928401|gb|AAD33583
          Length = 257

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +++     +P  G      +FH  CI  W R  +  P  RA
Sbjct: 112 ECSVCLSEFEEDDEGRVLPKCG-----HVFHVDCIDTWFRSRSSCPLCRA 156


>At5g66070.1 68418.m08324 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 221

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C +CL+       + ++P     +   MFH  CI +W R H   P  R
Sbjct: 176 CSVCLQDFQVGETVRSLP-----HCHHMFHLPCIDKWLRRHASCPLCR 218


>At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger)
           family protein low similarity to RING-H2 zinc finger
           protein ATL4 [Arabidopsis thaliana] GI:4928399; contains
           Pfam profile PF00097: Zinc finger, C3HC4 type (RING
           finger)
          Length = 375

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 1/62 (1%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA-IKYYFNFPQ 260
           EC +CL +  D   +  +P     N   +FH  CI  W + +   P  R  +    +FP 
Sbjct: 137 ECSVCLSEFQDEEKLRIIP-----NCSHLFHIDCIDVWLQNNANCPLCRTRVSCDTSFPP 191

Query: 261 KR 266
            R
Sbjct: 192 DR 193


>At5g41430.1 68418.m05032 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 161

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           C ICLE+++D   I+ +          +FH  CI  W +++   P
Sbjct: 117 CSICLEELEDGHEIIRIK-----KCRHVFHRSCIDSWLKQNRSCP 156


>At2g20030.1 68415.m02341 zinc finger (C3HC4-type RING finger)
           family protein similar to RING-H2 zinc finger protein
           ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam
           profile PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 390

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 15/49 (30%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL K +D   +  +P          FH  CI +W  +H   P  R
Sbjct: 123 ECSVCLSKFEDVEILRLLP-----KCRHAFHIGCIDQWLEQHATCPLCR 166


>At2g17450.1 68415.m02014 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 185

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 18/53 (33%), Positives = 23/53 (43%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           +TEC ICL    D   I  +P  G       FH +CI +W    +  P  R I
Sbjct: 99  STECAICLTDFADGEEIRVLPLCG-----HSFHVECIDKWLVSRSSCPSCRRI 146


>At3g60300.1 68416.m06740 RWD domain-containing protein contains
           weak similarity to RING finger protein 25 (RING finger
           protein AO7) (Swiss-Prot:Q9QZR0) [Mus musculus]
          Length = 366

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = +3

Query: 84  ECQICLEKI-DDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C +CL  +  ++GG   MP   +++    FH +CI RW
Sbjct: 120 DCPLCLYPLFPEDGGSKQMPFMKLMSCFHCFHCECIIRW 158


>At4g28370.1 68417.m04061 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam PF00097: Zinc finger, C3HC4
           type (RING finger)
          Length = 466

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           TT+C IC+  ID         D  +   E  FH  C+QRW
Sbjct: 413 TTDCVICMTAIDLRQHT---SDCMVTPCEHFFHSGCLQRW 449


>At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 302

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +C+ + +D+  +  MP+        +FH  C+  W  +H+  P  R
Sbjct: 95  ECAVCICEFEDHETLRLMPECC-----HVFHADCVSVWLSDHSTCPLCR 138


>At2g29840.1 68415.m03624 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 310

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           C ICLE+ DD   IVA+P          F ++C  +W
Sbjct: 261 CSICLEEFDDGRSIVALP------CGHEFDDECALKW 291


>At1g28040.1 68414.m03433 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 336

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/48 (31%), Positives = 21/48 (43%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C ICL +      +  MP+      +  FH QCI  W + H+  P  R
Sbjct: 290 CPICLSEYASKETVRCMPEC-----DHCFHVQCIDEWLKIHSSCPVCR 332


>At1g18780.1 68414.m02341 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 325

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           C ICLE+ DD   IV +P          F E+C+  W
Sbjct: 277 CTICLEEFDDGRSIVTLP------CGHEFDEECVLEW 307


>At5g20885.1 68418.m02480 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 176

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           C +CL  ++D   +       + N   MFH +CI RW
Sbjct: 82  CAVCLGDLEDGDEV-----RELRNCSHMFHRECIDRW 113


>At5g06490.1 68418.m00728 zinc finger (C3HC4-type RING finger)
           family protein low similarity to RING-H2 finger protein
           ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam
           profile PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 197

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/51 (33%), Positives = 21/51 (41%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T+ C ICL        I  +PD   L     FH+ C+  W R H   P  R
Sbjct: 126 TSCCSICLADYKKMDMIRVLPDCNHL-----FHDNCVDPWLRLHPTCPVCR 171


>At2g47560.1 68415.m05935 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 227

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + ++      +P  G       FH  CI  W R  +  P  RA
Sbjct: 107 ECSVCLSEFEEEDEGRLLPKCG-----HSFHVDCIDTWFRSRSTCPLCRA 151


>At2g42350.1 68415.m05241 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 217

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 13/50 (26%), Positives = 22/50 (44%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           TEC +CL  +++      +P     N + +FH  C+  W    +  P  R
Sbjct: 98  TECAVCLSLLEEKDNARMLP-----NCKHVFHVSCVDTWLTTQSTCPVCR 142


>At1g49230.1 68414.m05519 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 219

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = +3

Query: 69  PTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           P   TEC ICL +      +  +P          FH +CI +W   H+  P
Sbjct: 125 PGLDTECAICLSEFVAEERVKLLP-----TCHHGFHVRCIDKWLSSHSSCP 170


>At1g26800.1 68414.m03266 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 204

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/52 (32%), Positives = 22/52 (42%)
 Frame = +3

Query: 75  CTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C  EC ICLE+      +  MP       +  FH  CI++W   H   P  R
Sbjct: 109 CEGECVICLEEWKSEETVKEMP------CKHRFHGGCIEKWLGFHGSCPVCR 154


>At5g01880.1 68418.m00107 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 159

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/47 (31%), Positives = 19/47 (40%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           TEC ICL +  D   +  +P          FH  CI  W   H+  P
Sbjct: 103 TECAICLGEFADGERVRVLPP-----CNHSFHMSCIDTWLVSHSSCP 144


>At3g58720.1 68416.m06545 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 238

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 14/50 (28%), Positives = 23/50 (46%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           C +CLE  +    ++  P       + MFHE+CI  W +   + P  R +
Sbjct: 144 CSVCLEDFEPKETVMLTP------CKHMFHEECIVPWLKTKGQCPVCRFV 187


>At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 327

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/50 (32%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC ICL + +D   +  MP          FH  CI  W    +  P  RA
Sbjct: 127 ECAICLNEFEDEETLRLMPP-----CSHAFHASCIDVWLSSRSTCPVCRA 171


>At5g02750.1 68418.m00217 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 283

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 15/49 (30%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC IC E++ +   +  MP       +  FH +CI  W  +    PF R
Sbjct: 213 ECVICKEEMSEGRDVCEMP------CQHFFHWKCILPWLSKKNTCPFCR 255


>At4g24015.1 68417.m03451 zinc finger (RING-H2 type) protein-related
           low similarity to RING-H2 zinc finger protein ATL4
           [Arabidopsis thaliana] GI:4928399
          Length = 174

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 20/71 (28%), Positives = 32/71 (45%)
 Frame = +3

Query: 21  LKDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWR 200
           LKD+ + +  LF +   T  + C +CL + +    +V MP       + +FH  CI  W 
Sbjct: 85  LKDKLHVV--LFNEELGTRDSLCCVCLGEFELKEELVEMP-----LCKHIFHLDCIHLWL 137

Query: 201 REHTRDPFNRA 233
             H   P  R+
Sbjct: 138 YSHNTCPLCRS 148


>At4g02075.1 68417.m00278 zinc finger (C3HC4-type RING finger)
           family protein contains InterPro Entry IPR001841
           Zn-finger, RING
          Length = 218

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRRE 206
           T C+IC E+ +++   V    +G +   K  H  CIQRW  E
Sbjct: 18  TRCRICHEEEEESFFEVPCACSGTV---KFAHRNCIQRWCNE 56


>At3g14320.1 68416.m01811 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 204

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/49 (26%), Positives = 23/49 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL ++ D      +P     + +  FH +CI  W + ++  P  R
Sbjct: 87  ECVVCLSELADGDKARVLP-----SCDHWFHVECIDSWLQSNSTCPICR 130


>At2g25410.1 68415.m03043 hypothetical protein
          Length = 377

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           C ICL +      +  +P+      E  FH +CI  W + H+  P  R+
Sbjct: 327 CPICLSEYATKETVRCLPEC-----EHCFHTECIDAWLKLHSSCPVCRS 370


>At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein
           contains Pfam PF01422: NF-X1 type zinc finger; similar
           to transcriptional repressor NF-X1 (SP:Q12986) [Homo
           sapiens]; similar to EST gb|T21002
          Length = 1188

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHT 212
           EC IC +K+  +  I +       +   +FH  CI+RW R  T
Sbjct: 222 ECMICYDKVGRSANIWSCS-----SCYSIFHINCIKRWARAPT 259


>At5g43200.1 68418.m05278 zinc finger (C3HC4-type RING finger)
           family protein low similarity to RING-H2 finger protein
           RHY1a [Arabidopsis thaliana] GI:3790593; contains Pfam
           profile PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 207

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           C ICLE++  +     +P     N    FHE C+ +W
Sbjct: 156 CAICLEELSTSDDYCELP-----NCTHCFHEPCLTQW 187


>At2g15740.1 68415.m01802 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 329

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +2

Query: 359 TQEDALDIELDFRNFFKKCNHDERMVRDGR 448
           +Q  A    LD  +   K NHD+R+++DGR
Sbjct: 168 SQNSAYPQHLDMFSLSSKHNHDQRVLQDGR 197


>At1g21370.2 68414.m02674 expressed protein
          Length = 342

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +3

Query: 195 WRREHTRDPFNRAIKYYFNFPQ 260
           WR++  RDPF+R I Y    P+
Sbjct: 301 WRKKLNRDPFHRTIPYPIGCPE 322


>At1g21370.1 68414.m02673 expressed protein
          Length = 342

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +3

Query: 195 WRREHTRDPFNRAIKYYFNFPQ 260
           WR++  RDPF+R I Y    P+
Sbjct: 301 WRKKLNRDPFHRTIPYPIGCPE 322


>At1g20823.1 68414.m02608 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 197

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 16/51 (31%), Positives = 20/51 (39%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           EC ICL +      +  +P  G       FH  CI  W   H+  P  R I
Sbjct: 110 ECAICLAEFSAGDELRVLPQCG-----HGFHVACIDTWLGSHSSCPSCRQI 155


>At5g38070.1 68418.m04587 zinc finger (C3HC4-type RING finger)
           family protein contains InterPro Entry IPR001841
           Zn-finger, RING; contains PROSITE PS00190: Cytochrome c
           family heme-binding site signature
          Length = 259

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRRE 206
           +C+IC ++ +D         +G L   K  H  C+QRW  E
Sbjct: 53  QCRICHDEDEDTNMDTPCSCSGTL---KFAHHNCVQRWCNE 90


>At5g37280.1 68418.m04478 zinc finger (C3HC4-type RING finger)
           family protein low similarity to RING-H2 finger protein
           RHA1b [Arabidopsis thaliana] GI:3790567; contains Pfam
           profile PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 216

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 3/55 (5%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKM---FHEQCIQRWRREHTRDPFNRAIKY 242
           C IC EK+ D+  +       ++ + K    FH++CI +W       P  R + +
Sbjct: 159 CSICFEKLSDS--LSETYHNSIIQMPKCLHSFHQKCIFKWIGRQNSCPLCRRVPF 211


>At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger)
           family protein similar to Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 525

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRR 203
           +C IC E+  D        + G +  + M+H  C+Q+W R
Sbjct: 474 KCSICQEEYVDGD------ELGTIPCQHMYHVSCVQQWLR 507


>At4g23030.1 68417.m03321 MATE efflux protein-related contains Pfam
           profile PF01554: Uncharacterized membrane protein family
          Length = 502

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +3

Query: 312 AITKLIAFTSAFINALHKKTPWTLNSILGIFLKNAIMTNVWSATDVNLINCVL 470
           +IT  + +++ F   LH    + L S LG+ LK   +  +W  T+VNL+  ++
Sbjct: 181 SITLPLTYSAFFAVLLHIPINYLLVSSLGLGLKGVALGAIW--TNVNLLGFLI 231


>At4g09130.1 68417.m01507 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 357

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/50 (32%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC ICL + +D   +  MP          FH  CI  W    +  P  RA
Sbjct: 119 ECAICLCEFEDEEPLRWMPPCS-----HTFHANCIDEWLSSRSTCPVCRA 163


>At3g02800.1 68416.m00272 tyrosine specific protein phosphatase
           family protein contains tyrosine specific protein
           phosphatases active site, PROSITE:PS00383
          Length = 199

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +3

Query: 336 TSAFINALHKKTPWTLNSILGIFLKNAIMTNVWSATDVNLI 458
           T   +  L K   W L+S+L  + KNA +   W   D+N I
Sbjct: 115 TGCLVGCLRKVQSWCLSSVLEEYQKNAGLK--WRQRDLNFI 153


>At2g37580.1 68415.m04610 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type
          Length = 235

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/49 (26%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL    D+  +  + +      +  FH  CI+ W ++H   P  R
Sbjct: 141 ECSVCLMVFTDSDELRQLSEC-----KHAFHVLCIETWLKDHPNCPICR 184


>At2g20650.2 68415.m02422 zinc finger (C3HC4-type RING finger)
           family protein
          Length = 559

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C IC+  ID    I    D  +   E +FH  C+QRW
Sbjct: 508 DCVICMTTIDLRHRI---NDCMVTPCEHIFHSGCLQRW 542


>At2g20650.1 68415.m02421 zinc finger (C3HC4-type RING finger)
           family protein
          Length = 559

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C IC+  ID    I    D  +   E +FH  C+QRW
Sbjct: 508 DCVICMTTIDLRHRI---NDCMVTPCEHIFHSGCLQRW 542


>At1g76410.1 68414.m08881 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain, PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 185

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/51 (31%), Positives = 20/51 (39%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           EC ICL +      +  +P  G       FH  CI  W   H+  P  R I
Sbjct: 103 ECAICLTEFAAGDELRVLPQCG-----HGFHVSCIDTWLGSHSSCPSCRQI 148


>At5g55970.2 68418.m06981 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 343

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRR 203
           EC ICL K  D   +  +P          FH +C+ +W R
Sbjct: 296 ECCICLAKYKDKEEVRKLP------CSHKFHSKCVDQWLR 329


>At5g55970.1 68418.m06980 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 343

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRR 203
           EC ICL K  D   +  +P          FH +C+ +W R
Sbjct: 296 ECCICLAKYKDKEEVRKLP------CSHKFHSKCVDQWLR 329


>At5g05530.1 68418.m00600 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 199

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 8/77 (10%)
 Frame = +3

Query: 24  KDRNYYMFKLFKDYWPTC--------TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHE 179
           +D  Y++ +  K  W TC          EC ICLE++  +   +   D        +FH+
Sbjct: 120 EDVEYHLMEESKG-WTTCIPAKSITPVNECTICLEELCHDEESIETHDCC-----HVFHK 173

Query: 180 QCIQRWRREHTRDPFNR 230
            C+ RW R  +  P  R
Sbjct: 174 LCLWRWIRTKSSCPLCR 190


>At4g09120.1 68417.m01505 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 345

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 16/50 (32%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC ICL + +D   +  MP          FH  CI  W    +  P  RA
Sbjct: 122 ECAICLSEFEDQETLRWMPP-----CSHTFHANCIDVWLSSWSTCPVCRA 166


>At3g18930.2 68416.m02403 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 Zinc
           finger, C3HC4 type (RING finger)
          Length = 411

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/49 (26%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +C +CL + ++   +  +P          FH +CI  W R H   P  R
Sbjct: 155 DCAVCLLEFEEGDYVRTLP-----LCFHAFHLECIDEWLRSHPNCPLCR 198


>At3g18930.1 68416.m02402 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 Zinc
           finger, C3HC4 type (RING finger)
          Length = 411

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/49 (26%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +C +CL + ++   +  +P          FH +CI  W R H   P  R
Sbjct: 155 DCAVCLLEFEEGDYVRTLP-----LCFHAFHLECIDEWLRSHPNCPLCR 198


>At2g17730.1 68415.m02054 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam PF00097: Zinc finger, C3HC4
           type (RING finger) domain; similar to RING-H2 finger
           protein RHA3a (GI:3790573) [Arabidopsis thaliana];
           similar to ReMembR-H2 protein JR700 (GI:6942147)
           [Arabidopsis thaliana]
          Length = 241

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 14/51 (27%), Positives = 20/51 (39%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T  C +CL+       + ++P     +   MFH  CI  W   H   P  R
Sbjct: 193 TDSCSVCLQDFQLGETVRSLP-----HCHHMFHLPCIDNWLLRHGSCPMCR 238


>At2g01760.1 68415.m00106 two-component responsive regulator family
           protein / response regulator family protein similar to
           response regulator 9 (GI:14189890) [Zea mays]; similar
           to ARR1 protein (GI:4210449) [Arabidopsis thaliana];
           contains Pfam profile: PF00072 response regulator
           receiver domain
          Length = 382

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = +3

Query: 576 KPMRPPKPMQCWIHPRRANCKVTRP-RNNYSDPDNENDMLHMTVLNSV 716
           KP+RP +    W H  R  C + +  R++ +  DN+N     TV+ SV
Sbjct: 113 KPIRPEELKNIWQHVVRRKCVMKKELRSSQALEDNKNSGSLETVVVSV 160


>At1g72310.1 68414.m08359 zinc finger (C3HC4-type RING finger)
           family protein (ATL3) identical to RING-H2 zinc finger
           protein (ATL3) GB:AF132013 (Arabidopsis thaliana)
          Length = 324

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 14/49 (28%), Positives = 20/49 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC ICL ++        +P          FH +CI  W + H+  P  R
Sbjct: 126 ECSICLSELVKGDKARLLP-----KCNHSFHVECIDMWFQSHSTCPICR 169


>At1g61780.1 68414.m06967 postsynaptic protein-related similar to
           postsynaptic protein CRIPT GI:3098551 from [Rattus
           norvegicus]
          Length = 98

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 8/19 (42%), Positives = 14/19 (73%)
 Frame = +3

Query: 66  WPTCTTECQICLEKIDDNG 122
           + TCTT+C IC +++  +G
Sbjct: 49  YSTCTTKCMICKQQVHQDG 67


>At1g57570.1 68414.m06533 jacalin lectin family protein similar to
           myrosinase-binding protein homolog [Arabidopsis
           thaliana] GI:2997767; contains Pfam profile PF01419
           jacalin-like lectin domain
          Length = 614

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = +3

Query: 609 WIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNSV 716
           WIHPR+   K ++  N + D  N + +  + V   V
Sbjct: 169 WIHPRKMEAKGSKGGNQWDDGTNNDGVTKIHVRGGV 204


>At1g53820.1 68414.m06126 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 310

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 14/49 (28%), Positives = 19/49 (38%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL  + D      +P          FH  CI  W + H+  P  R
Sbjct: 119 ECAVCLSDLVDGDKARVLP-----RCNHGFHVDCIDMWFQSHSTCPLCR 162


>At1g49850.1 68414.m05589 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 250

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRR 203
           +C ICLE       ++++P T        FH  C+  W R
Sbjct: 202 DCSICLESFTKGDMLISLPCT------HSFHSSCLNPWLR 235


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,673,414
Number of Sequences: 28952
Number of extensions: 297448
Number of successful extensions: 889
Number of sequences better than 10.0: 75
Number of HSP's better than 10.0 without gapping: 846
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 862
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -