SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) ...   126   2e-29
At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica...   125   3e-29
At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica...   125   3e-29
At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar...   107   7e-24
At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar...   105   2e-23
At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical ...   104   6e-23
At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical ...   104   6e-23
At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical ...   104   6e-23
At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative simila...   102   2e-22
At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila...    99   2e-21
At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar...    96   2e-20
At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar...    96   2e-20
At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar...    96   2e-20
At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ...    92   3e-19
At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ...    92   3e-19
At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative simila...    81   5e-16
At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar...    79   4e-15
At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative           76   2e-14
At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly iden...    73   2e-13
At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA...    72   4e-13
At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative              71   7e-13
At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative simila...    70   1e-12
At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative simila...    70   1e-12
At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar...    70   1e-12
At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s...    70   2e-12
At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)...    67   9e-12
At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)...    67   9e-12
At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative              61   8e-10
At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)...    61   8e-10
At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id...    60   1e-09
At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong ...    60   2e-09
At2g07750.1 68415.m01003 DEAD box RNA helicase, putative similar...    59   3e-09
At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)...    58   4e-09
At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA he...    58   4e-09
At1g63250.1 68414.m07150 DEAD box RNA helicase, putative similar...    58   4e-09
At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim...    58   5e-09
At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein c...    58   7e-09
At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein c...    58   7e-09
At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative simila...    56   2e-08
At3g19760.1 68416.m02501 eukaryotic translation initiation facto...    56   3e-08
At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18)       55   4e-08
At1g51380.1 68414.m05780 eukaryotic translation initiation facto...    55   5e-08
At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)...    54   9e-08
At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai...    54   1e-07
At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical ...    54   1e-07
At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contai...    54   1e-07
At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative simila...    54   1e-07
At3g13920.1 68416.m01758 eukaryotic translation initiation facto...    53   2e-07
At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila...    53   2e-07
At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contai...    52   4e-07
At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative non-co...    52   5e-07
At1g72730.1 68414.m08410 eukaryotic translation initiation facto...    51   8e-07
At1g54270.1 68414.m06187 eukaryotic translation initiation facto...    51   8e-07
At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative              46   2e-05
At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)...    46   2e-05
At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)...    46   2e-05
At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative simila...    42   4e-04
At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /...    41   9e-04
At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)...    40   0.001
At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)...    38   0.006
At4g15850.1 68417.m02410 DEAD/DEAH box helicase, putative simila...    37   0.014
At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA he...    34   0.076
At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative EUKARY...    33   0.17 
At1g59990.1 68414.m06758 DEAD/DEAH box helicase, putative (RH22)...    32   0.40 
At1g71390.1 68414.m08243 disease resistance family protein / LRR...    29   2.2  
At2g28600.1 68415.m03476 expressed protein                             29   2.8  
At5g62370.1 68418.m07828 pentatricopeptide (PPR) repeat-containi...    29   3.8  
At4g13920.1 68417.m02154 disease resistance family protein / LRR...    28   5.0  
At4g13810.1 68417.m02140 disease resistance family protein / LRR...    28   5.0  
At3g60970.1 68416.m06823 ABC transporter family protein ABC tran...    28   5.0  
At3g60160.1 68416.m06717 ABC transporter family protein similar ...    28   5.0  
At3g04670.1 68416.m00500 WRKY family transcription factor simila...    28   5.0  
At1g15820.1 68414.m01898 chlorophyll A-B binding protein, chloro...    28   5.0  
At5g27300.1 68418.m03260 pentatricopeptide (PPR) repeat-containi...    28   6.6  
At2g27800.1 68415.m03370 pentatricopeptide (PPR) repeat-containi...    28   6.6  
At2g33670.1 68415.m04126 seven transmembrane MLO family protein ...    27   8.7  
At1g42560.1 68414.m04907 seven transmembrane MLO family protein ...    27   8.7  

>At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20)
           similar to ethylene-responsive RNA helicase GI:5669638
           from [Lycopersicon esculentum]; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 501

 Score =  126 bits (303), Expect = 2e-29
 Identities = 57/84 (67%), Positives = 69/84 (82%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVH+N QP +  GDGPI LVLAPTRELA QIQQ A+ FG +S ++ TC
Sbjct: 146 GSGKTLSYLLPAIVHVNAQPMLAHGDGPIVLVLAPTRELAVQIQQEASKFGSSSKIKTTC 205

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG PK  Q RDL++GVEIVIAT
Sbjct: 206 IYGGVPKGPQVRDLQKGVEIVIAT 229



 Score =  122 bits (294), Expect = 2e-28
 Identities = 56/84 (66%), Positives = 68/84 (80%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID +E   TNL+R TYLVLDEADRMLDMGF+PQIRKI+  IRPDRQTL WSATWPKE
Sbjct: 231 GRLIDMMESNNTNLRRVTYLVLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKE 290

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++L++ +L +  ++ IGS  L A
Sbjct: 291 VEQLSKKFLYNPYKVIIGSSDLKA 314



 Score = 34.7 bits (76), Expect = 0.057
 Identities = 18/45 (40%), Positives = 29/45 (64%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N  I QIVD+  E +K NKL  LL++I      G++ ++F++TK+
Sbjct: 315 NRAIRQIVDVISESQKYNKLVKLLEDI----MDGSRILVFLDTKK 355


>At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 591

 Score =  125 bits (301), Expect = 3e-29
 Identities = 60/84 (71%), Positives = 67/84 (79%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE   TNL+R TYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTL+WSATWP+E
Sbjct: 297 GRLIDMLECQHTNLKRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPRE 356

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LA  +L D  +  IGS  L A
Sbjct: 357 VETLARQFLRDPYKAIIGSTDLKA 380



 Score =  119 bits (287), Expect = 2e-27
 Identities = 56/84 (66%), Positives = 68/84 (80%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPA+VH++ QP + + DGPI L+LAPTRELA QIQ+ +  FG  S VR+TC
Sbjct: 212 GSGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEESRKFGLRSGVRSTC 271

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDL RGVEIVIAT
Sbjct: 272 IYGGAPKGPQIRDLRRGVEIVIAT 295



 Score = 35.1 bits (77), Expect = 0.043
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q+++I    EK N+L  LL+++      G+K +IFVETKR
Sbjct: 381 NQSINQVIEIVPTPEKYNRLLTLLKQLMD----GSKILIFVETKR 421


>At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 484

 Score =  125 bits (301), Expect = 3e-29
 Identities = 60/84 (71%), Positives = 67/84 (79%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE   TNL+R TYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTL+WSATWP+E
Sbjct: 297 GRLIDMLECQHTNLKRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPRE 356

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LA  +L D  +  IGS  L A
Sbjct: 357 VETLARQFLRDPYKAIIGSTDLKA 380



 Score =  119 bits (287), Expect = 2e-27
 Identities = 56/84 (66%), Positives = 68/84 (80%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPA+VH++ QP + + DGPI L+LAPTRELA QIQ+ +  FG  S VR+TC
Sbjct: 212 GSGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEESRKFGLRSGVRSTC 271

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDL RGVEIVIAT
Sbjct: 272 IYGGAPKGPQIRDLRRGVEIVIAT 295



 Score = 35.1 bits (77), Expect = 0.043
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q+++I    EK N+L  LL+++      G+K +IFVETKR
Sbjct: 381 NQSINQVIEIVPTPEKYNRLLTLLKQLMD----GSKILIFVETKR 421


>At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 1088

 Score =  107 bits (257), Expect = 7e-24
 Identities = 50/78 (64%), Positives = 62/78 (79%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    + Q+ + LVLDEADRMLDMGFEPQIRKI+ +I P RQTLM++ATWPKE
Sbjct: 566 GRLNDILEMKMIDFQQVSLLVLDEADRMLDMGFEPQIRKIVNEIPPRRQTLMYTATWPKE 625

Query: 437 VKKLAEDYLGDYIQINIG 490
           V+K+A D L + +Q+NIG
Sbjct: 626 VRKIASDLLVNPVQVNIG 643



 Score = 90.6 bits (215), Expect = 8e-19
 Identities = 44/84 (52%), Positives = 59/84 (70%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++PA + + +     R +GP  L+LAPTRELA QIQ  A  FG +S +  TC
Sbjct: 482 GSGKTLGYLIPAFILLRHCRNDSR-NGPTVLILAPTRELATQIQDEALRFGRSSRISCTC 540

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q ++LERG +IV+AT
Sbjct: 541 LYGGAPKGPQLKELERGADIVVAT 564



 Score = 35.5 bits (78), Expect = 0.033
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N  I Q V++  + EKE +L  +L+    SQE G+K IIF  TKR
Sbjct: 651 NKAITQYVEVVPQMEKERRLEQILR----SQERGSKVIIFCSTKR 691


>At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 713

 Score =  105 bits (253), Expect = 2e-23
 Identities = 49/80 (61%), Positives = 63/80 (78%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L + +YLVLDEADRMLDMGFEPQIRKI+ ++   RQTLM++ATWPKE
Sbjct: 360 GRLNDILEMKRISLHQVSYLVLDEADRMLDMGFEPQIRKIVNEVPTKRQTLMYTATWPKE 419

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V+K+A D L +  Q+NIG++
Sbjct: 420 VRKIAADLLVNPAQVNIGNV 439



 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 43/84 (51%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++P  +H+       R  GP  LVL+PTRELA QIQ  A  FG +S +   C
Sbjct: 276 GSGKTLGYLIPGFMHLQRIHNDSRM-GPTILVLSPTRELATQIQVEALKFGKSSKISCAC 334

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q +++ERGV+IV+AT
Sbjct: 335 LYGGAPKGPQLKEIERGVDIVVAT 358



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q +++    EK ++L  +L+    SQEPG+K IIF  TKR
Sbjct: 445 NKSITQTIEVLAPMEKHSRLEQILR----SQEPGSKIIIFCSTKR 485


>At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score =  104 bits (249), Expect = 6e-23
 Identities = 49/80 (61%), Positives = 64/80 (80%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L++ +YLVLDEADRMLDMGFEPQIRKI+++I   RQTLM++ATWPK 
Sbjct: 289 GRLNDILEMRRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPTKRQTLMYTATWPKG 348

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V+K+A D L +  Q+NIG++
Sbjct: 349 VRKIAADLLVNPAQVNIGNV 368



 Score = 93.9 bits (223), Expect = 9e-20
 Identities = 46/84 (54%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++P  +H+       R  GP  LVL+PTRELA QIQ+ A  FG +S +  TC
Sbjct: 205 GSGKTLGYLIPGFLHLQRIRNDSRM-GPTILVLSPTRELATQIQEEAVKFGRSSRISCTC 263

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERG +IV+AT
Sbjct: 264 LYGGAPKGPQLRDLERGADIVVAT 287



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q +++    EK+ +L  +L+    SQEPG+K IIF  TKR
Sbjct: 374 NKSITQHIEVVAPMEKQRRLEQILR----SQEPGSKVIIFCSTKR 414


>At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score =  104 bits (249), Expect = 6e-23
 Identities = 49/80 (61%), Positives = 64/80 (80%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L++ +YLVLDEADRMLDMGFEPQIRKI+++I   RQTLM++ATWPK 
Sbjct: 289 GRLNDILEMRRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPTKRQTLMYTATWPKG 348

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V+K+A D L +  Q+NIG++
Sbjct: 349 VRKIAADLLVNPAQVNIGNV 368



 Score = 93.9 bits (223), Expect = 9e-20
 Identities = 46/84 (54%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++P  +H+       R  GP  LVL+PTRELA QIQ+ A  FG +S +  TC
Sbjct: 205 GSGKTLGYLIPGFLHLQRIRNDSRM-GPTILVLSPTRELATQIQEEAVKFGRSSRISCTC 263

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERG +IV+AT
Sbjct: 264 LYGGAPKGPQLRDLERGADIVVAT 287



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q +++    EK+ +L  +L+    SQEPG+K IIF  TKR
Sbjct: 374 NKSITQHIEVVAPMEKQRRLEQILR----SQEPGSKVIIFCSTKR 414


>At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 618

 Score =  104 bits (249), Expect = 6e-23
 Identities = 49/80 (61%), Positives = 64/80 (80%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L++ +YLVLDEADRMLDMGFEPQIRKI+++I   RQTLM++ATWPK 
Sbjct: 289 GRLNDILEMRRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPTKRQTLMYTATWPKG 348

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V+K+A D L +  Q+NIG++
Sbjct: 349 VRKIAADLLVNPAQVNIGNV 368



 Score = 93.9 bits (223), Expect = 9e-20
 Identities = 46/84 (54%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++P  +H+       R  GP  LVL+PTRELA QIQ+ A  FG +S +  TC
Sbjct: 205 GSGKTLGYLIPGFLHLQRIRNDSRM-GPTILVLSPTRELATQIQEEAVKFGRSSRISCTC 263

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERG +IV+AT
Sbjct: 264 LYGGAPKGPQLRDLERGADIVVAT 287



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q +++    EK+ +L  +L+    SQEPG+K IIF  TKR
Sbjct: 374 NKSITQHIEVVAPMEKQRRLEQILR----SQEPGSKVIIFCSTKR 414


>At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative similar
           to RNA helicase [Rattus norvegicus] GI:897915; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 760

 Score =  102 bits (245), Expect = 2e-22
 Identities = 46/83 (55%), Positives = 63/83 (75%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID L+     + R +YLVLDEADRM D+GFEPQ+R I+ QIRPDRQTL++SAT P +
Sbjct: 360 GRLIDMLKMKALTMMRASYLVLDEADRMFDLGFEPQVRSIVGQIRPDRQTLLFSATMPWK 419

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           V+KLA + L D I++ +G + ++
Sbjct: 420 VEKLAREILSDPIRVTVGEVGMA 442



 Score = 90.2 bits (214), Expect = 1e-18
 Identities = 43/84 (51%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP IVHI +QP ++R +GPI ++ APTRELA QI   A  F     +R + 
Sbjct: 275 GSGKTAAFVLPMIVHIMDQPELQRDEGPIGVICAPTRELAHQIFLEAKKFSKAYGLRVSA 334

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG  K EQ ++L+ G EIV+AT
Sbjct: 335 VYGGMSKHEQFKELKAGCEIVVAT 358


>At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar
           to RNA helicase GB:A57514 GI:897915 from [Rattus
           norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 989

 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 48/93 (51%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TYLV+DEADRM DMGFEPQI +I++ IR
Sbjct: 516 LKRGTEIVVCTPGRMIDILCTSSGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIR 575

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+++SAT+P++V+ LA   L   ++I +G
Sbjct: 576 PDRQTVLFSATFPRQVETLARKVLNKPVEIQVG 608



 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 41/84 (48%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL ++LP + HI +QPP+  GDGPI LV+APTREL QQI      F     +    
Sbjct: 443 GSGKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPTRELVQQIYSDIRKFSKALGIICVP 502

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+   +Q  +L+RG EIV+ T
Sbjct: 503 VYGGSGVAQQISELKRGTEIVVCT 526


>At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to
           RNA helicase [Rattus norvegicus] GI:897915; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 1166

 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R T+LV+DEADRM DMGFEPQI +II+ IR
Sbjct: 649 LKRGTEIVVCTPGRMIDILCTSSGKITNLRRVTFLVMDEADRMFDMGFEPQITRIIQNIR 708

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           P+RQT+++SAT+P++V+ LA   L   ++I +G
Sbjct: 709 PERQTVLFSATFPRQVETLARKVLNKPVEIQVG 741



 Score = 91.1 bits (216), Expect = 6e-19
 Identities = 42/84 (50%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL ++LP + HI +QPP+  GDGPI LV+APTREL QQI      F     +R   
Sbjct: 576 GSGKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPTRELVQQIHSDIRKFSKPLGIRCVP 635

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+   +Q  +L+RG EIV+ T
Sbjct: 636 VYGGSGVAQQISELKRGTEIVVCT 659


>At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 646

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 46/82 (56%), Positives = 64/82 (78%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-RPD---RQTLMWSAT 424
           GRL D LE+G  +LQ   +L LDEADRMLDMGFEPQIRKI++Q+  P    RQT+++SAT
Sbjct: 283 GRLNDLLERGRVSLQMVRFLALDEADRMLDMGFEPQIRKIVQQMDMPPPGVRQTMLFSAT 342

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P+E+++LA D+L +YI + +G
Sbjct: 343 FPREIQRLASDFLSNYIFLAVG 364



 Score = 72.1 bits (169), Expect = 3e-13
 Identities = 39/89 (43%), Positives = 53/89 (59%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-----PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+  P I  I     I R  G     P+A++L+PTRELA QI   A  F + + 
Sbjct: 193 GSGKTAAFCFPIISGIMKDQHIERPRGVRGVYPLAVILSPTRELACQIHDEARKFSYQTG 252

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           V+    +GG P  +Q R+LERGV+I++AT
Sbjct: 253 VKVVVAYGGTPVNQQIRELERGVDILVAT 281


>At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 633

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 46/82 (56%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL D LE+   ++Q   +L LDEADRMLDMGFEPQIRKI+EQ+    R  RQTL++SAT
Sbjct: 296 GRLNDLLERARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTLLFSAT 355

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P+E+++LA D+L +YI + +G
Sbjct: 356 FPREIQRLAADFLANYIFLAVG 377



 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 38/89 (42%), Positives = 54/89 (60%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-----PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+  P I  I     ++R  G     P+A++L+PTRELA QI   A  F + + 
Sbjct: 206 GSGKTAAFCFPIISGIMKDQHVQRPRGSRTVYPLAVILSPTRELASQIHDEAKKFSYQTG 265

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           V+    +GG P  +Q R+LERGV+I++AT
Sbjct: 266 VKVVVAYGGTPINQQLRELERGVDILVAT 294


>At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 43/82 (52%), Positives = 62/82 (75%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL D LE+   ++Q   +L LDEADRMLDMGFEPQIRKI+EQ+    R  RQT+++SAT
Sbjct: 288 GRLNDLLERARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSAT 347

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P ++++LA D++ +YI + +G
Sbjct: 348 FPSQIQRLAADFMSNYIFLAVG 369



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-----PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+  P I  I     + R  G     P A++L+PTRELA QI   A  F + + 
Sbjct: 198 GSGKTAAFCFPIISGIMKDQHVERPRGSRAVYPFAVILSPTRELACQIHDEAKKFSYQTG 257

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           V+    +GG P  +Q R+LERG +I++AT
Sbjct: 258 VKVVVAYGGTPIHQQLRELERGCDILVAT 286



 Score = 33.9 bits (74), Expect = 0.10
 Identities = 18/48 (37%), Positives = 28/48 (58%)
 Frame = +1

Query: 517 ILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKLRTYQ 660
           I Q V+  QE +K + L  LL    ++Q+  + T++FVETKR   T +
Sbjct: 378 ITQRVEFVQESDKRSHLMDLLHAQRETQDKQSLTLVFVETKRGADTLE 425


>At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 43/82 (52%), Positives = 62/82 (75%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL D LE+   ++Q   +L LDEADRMLDMGFEPQIRKI+EQ+    R  RQT+++SAT
Sbjct: 288 GRLNDLLERARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSAT 347

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P ++++LA D++ +YI + +G
Sbjct: 348 FPSQIQRLAADFMSNYIFLAVG 369



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-----PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+  P I  I     + R  G     P A++L+PTRELA QI   A  F + + 
Sbjct: 198 GSGKTAAFCFPIISGIMKDQHVERPRGSRAVYPFAVILSPTRELACQIHDEAKKFSYQTG 257

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           V+    +GG P  +Q R+LERG +I++AT
Sbjct: 258 VKVVVAYGGTPIHQQLRELERGCDILVAT 286



 Score = 33.9 bits (74), Expect = 0.10
 Identities = 18/48 (37%), Positives = 28/48 (58%)
 Frame = +1

Query: 517 ILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKLRTYQ 660
           I Q V+  QE +K + L  LL    ++Q+  + T++FVETKR   T +
Sbjct: 378 ITQRVEFVQESDKRSHLMDLLHAQRETQDKQSLTLVFVETKRGADTLE 425


>At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative similar
           to p68 RNA helicase [Schizosaccharomyces pombe]
           GI:173419
          Length = 537

 Score = 81.4 bits (192), Expect = 5e-16
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D +E     L   +++VLDEADRMLDMGFE  +R I+      RQ +M+SATWP +
Sbjct: 250 GRLRDLIESNVLRLSDVSFVVLDEADRMLDMGFEEPVRFILSNTNKVRQMVMFSATWPLD 309

Query: 437 VKKLAEDYLG-DYIQINIGSLQLSA 508
           V KLA++++  + I++ IGS+ L+A
Sbjct: 310 VHKLAQEFMDPNPIKVIIGSVDLAA 334



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIRRGD---GPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKTLA+ +PAI+H+      I  G     P  LVL+PTRELA QI  V  + G    +
Sbjct: 161 GSGKTLAFGIPAIMHVLKKNKKIGGGSKKVNPTCLVLSPTRELAVQISDVLREAGEPCGL 220

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           ++ CV+GG+ K  Q   +  GV+IVI T
Sbjct: 221 KSICVYGGSSKGPQISAIRSGVDIVIGT 248



 Score = 30.7 bits (66), Expect = 0.93
 Identities = 10/32 (31%), Positives = 23/32 (71%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQE 603
           NH+++QI+++  E  ++ +L  LL++  +SQ+
Sbjct: 335 NHDVMQIIEVLDERARDQRLIALLEKYHKSQK 366


>At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar to
           SP|P23394 Pre-mRNA splicing factor RNA helicase PRP28
           {Saccharomyces cerevisiae}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 733

 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 40/87 (45%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI---RRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A++LP + +I+  PP+      +GP A+V+APTRELAQQI++    F H    R
Sbjct: 360 GSGKTAAFVLPMLAYISRLPPMSEENETEGPYAVVMAPTRELAQQIEEETVKFAHYLGFR 419

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
            T + GG    EQ   + +G EIVIAT
Sbjct: 420 VTSIVGGQSIEEQGLKITQGCEIVIAT 446



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 40/96 (41%), Positives = 58/96 (60%), Gaps = 17/96 (17%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------- 397
           GRLID LE+    L +C Y+VLDEADRM+DMGFEPQ+  +++      ++P+        
Sbjct: 448 GRLIDCLERRYAVLNQCNYVVLDEADRMIDMGFEPQVAGVLDAMPSSNLKPENEEEELDE 507

Query: 398 ----RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
               R T M+SAT P  V++LA  YL + + + IG+
Sbjct: 508 KKIYRTTYMFSATMPPGVERLARKYLRNPVVVTIGT 543


>At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative 
          Length = 591

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 34/78 (43%), Positives = 50/78 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   +L  C YL LDEADR++D+GFE  IR++ +  +  RQTL++SAT P +
Sbjct: 287 GRLKDMLAKKKMSLDACRYLTLDEADRLVDLGFEDDIREVFDHFKSQRQTLLFSATMPTK 346

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + +N+G
Sbjct: 347 IQIFARSALVKPVTVNVG 364



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 37/93 (39%), Positives = 53/93 (56%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQ----IQQVAADFGHT 161
           GSGKTL ++LP I+    +    PI  G+GPI L++ P+RELA+Q    ++Q  A     
Sbjct: 193 GSGKTLVFVLPMIMIALQEEMMMPIAAGEGPIGLIVCPSRELARQTYEVVEQFVAPLVEA 252

Query: 162 SY--VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            Y  +R+    GG   R Q   ++RGV IV+AT
Sbjct: 253 GYPPLRSLLCIGGIDMRSQLEVVKRGVHIVVAT 285


>At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:3775987; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain, PF00098: Zinc knuckle
          Length = 747

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 35/77 (45%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID +E  +  L    YLVLDEAD+ML +GFE  +  I+E +   RQ++++SAT P  
Sbjct: 237 GRIIDLIEGRSLKLGEVEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTW 296

Query: 437 VKKLAEDYLGDYIQINI 487
           VKKLA  YL + + I++
Sbjct: 297 VKKLARKYLDNPLNIDL 313



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP----PIRR-GDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           G+GKTLA+ +P I  +  +       RR G  P  LVLAPTRELA+Q+++   +     Y
Sbjct: 149 GTGKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTRELAKQVEKEIKE--SAPY 206

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           +   CV+GG     Q   L RGV++V+ T
Sbjct: 207 LSTVCVYGGVSYTIQQSALTRGVDVVVGT 235


>At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA
           helicase DBP2 - Saccharomyces cerevisiae, PID:g5272
          Length = 542

 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 33/78 (42%), Positives = 48/78 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   +L  C  L LDEADR++D+GFE  IR + +  +  RQTL++SAT P +
Sbjct: 238 GRLKDILAKKKMSLDACRLLTLDEADRLVDLGFEDDIRHVFDHFKSQRQTLLFSATMPAK 297

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + +N+G
Sbjct: 298 IQIFATSALVKPVTVNVG 315



 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 38/93 (40%), Positives = 54/93 (58%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQ----IQQVAADFGHT 161
           GSGKTL ++LP I+    +    PI  G+GPIALV+ P+RELA+Q    ++Q  A     
Sbjct: 144 GSGKTLVFVLPMIILALQEEIMMPIAAGEGPIALVICPSRELAKQTYDVVEQFVASLVED 203

Query: 162 SY--VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            Y  +R+    GG   R Q   +++GV IV+AT
Sbjct: 204 GYPRLRSLLCIGGVDMRSQLDVVKKGVHIVVAT 236


>At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative
          Length = 528

 Score = 70.9 bits (166), Expect = 7e-13
 Identities = 35/90 (38%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  +KG   L+ C  LV+DEAD++L + F+P I ++I+ +   RQ LM+SAT+P  
Sbjct: 281 GRILDLAKKGVCVLKDCAMLVMDEADKLLSVEFQPSIEELIQFLPESRQILMFSATFPVT 340

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   + YL     IN+   L L  +T ++
Sbjct: 341 VKSFKDRYLKKPYIINLMDQLTLMGVTQYY 370



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 24/84 (28%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  I+ +  + +     A++L PTRELA Q  QV  +      +    
Sbjct: 201 GTGKTGAFCIPTLEKIDPENNVIQ-----AVILVPTRELALQTSQVCKELSKYLKIEVMV 255

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   R+    L + V +++ T
Sbjct: 256 TTGGTSLRDDIMRLYQPVHLLVGT 279


>At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 35/90 (38%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  +KG   L+ C+ LV+DEAD++L   F+P +  +I  +   RQ LM+SAT+P  
Sbjct: 258 GRILDLTKKGVCVLKDCSVLVMDEADKLLSQEFQPSVEHLISFLPESRQILMFSATFPVT 317

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   + +L +   IN+   L L  IT F+
Sbjct: 318 VKDFKDRFLTNPYVINLMDELTLKGITQFY 347



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 23/84 (27%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  I+    + +     A+++ PTRELA Q  QV  + G    ++   
Sbjct: 178 GTGKTAAFCIPVLEKIDQDNNVIQ-----AVIIVPTRELALQTSQVCKELGKHLKIQVMV 232

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    L + V +++ T
Sbjct: 233 TTGGTSLKDDIMRLYQPVHLLVGT 256


>At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 35/90 (38%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  +KG   L+ C+ LV+DEAD++L   F+P +  +I  +   RQ LM+SAT+P  
Sbjct: 258 GRILDLTKKGVCVLKDCSVLVMDEADKLLSQEFQPSVEHLISFLPESRQILMFSATFPVT 317

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   + +L +   IN+   L L  IT F+
Sbjct: 318 VKDFKDRFLTNPYVINLMDELTLKGITQFY 347



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 23/84 (27%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  I+    + +     A+++ PTRELA Q  QV  + G    ++   
Sbjct: 178 GTGKTAAFCIPVLEKIDQDNNVIQ-----AVIIVPTRELALQTSQVCKELGKHLKIQVMV 232

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    L + V +++ T
Sbjct: 233 TTGGTSLKDDIMRLYQPVHLLVGT 256


>At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to
           RNA helicases GI:3775995, GI:3775987 from [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 616

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 29/77 (37%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID +++G  NL    ++VLDEAD+ML +GF   +  I+E++   RQ++M+SAT P  
Sbjct: 235 GRVIDLMKRGALNLSEVQFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSW 294

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ L + YL + + +++
Sbjct: 295 IRSLTKKYLNNPLTVDL 311



 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 35/86 (40%), Positives = 54/86 (62%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTLA+ +P I  I        RG  P+ LVLAPTRELA+Q+++   +F  ++   +T
Sbjct: 151 GTGKTLAFGIPIIDKIIKYNAKHGRGRNPLCLVLAPTRELARQVEK---EFRESAPSLDT 207

Query: 180 -CVFGGAPKREQARDLERGVEIVIAT 254
            C++GG P  +Q R L+ GV++ + T
Sbjct: 208 ICLYGGTPIGQQMRQLDYGVDVAVGT 233


>At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9)
           similar to RNA helicases GI:3775995, GI:3775987
           [Arabidopsis thaliana]; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 610

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 29/77 (37%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID +++G  NL    ++VLDEAD+ML +GF   +  I++++   RQ++M+SAT P  
Sbjct: 247 GRIIDLMKRGALNLSEVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSW 306

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ L + YL + + I++
Sbjct: 307 IRSLTKKYLNNPLTIDL 323



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 34/86 (39%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTLA+ +P I  I        RG  P  LVLAPTRELA+Q+++   +F  ++   +T
Sbjct: 163 GTGKTLAFGIPIIDKIIKFNAKHGRGKNPQCLVLAPTRELARQVEK---EFRESAPSLDT 219

Query: 180 -CVFGGAPKREQARDLERGVEIVIAT 254
            C++GG P  +Q R+L  G+++ + T
Sbjct: 220 ICLYGGTPIGQQMRELNYGIDVAVGT 245


>At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 33/90 (36%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  +KG   L+ C  LV+DEAD++L   F+P + ++I+ +  +RQ LM+SAT+P  
Sbjct: 251 GRILDLTKKGVCVLKDCAMLVMDEADKLLSAEFQPSLEELIQFLPQNRQFLMFSATFPVT 310

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   + +L     IN+   L L  +T ++
Sbjct: 311 VKAFKDRHLRKPYVINLMDQLTLMGVTQYY 340



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/84 (28%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  I+    + +     A++L PTRELA Q  QV  +      ++   
Sbjct: 171 GTGKTGAFCIPVLEKIDPNNNVIQ-----AMILVPTRELALQTSQVCKELSKYLNIQVMV 225

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   R+    L + V +++ T
Sbjct: 226 TTGGTSLRDDIMRLHQPVHLLVGT 249


>At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 33/90 (36%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  +KG   L+ C  LV+DEAD++L   F+P + ++I+ +  +RQ LM+SAT+P  
Sbjct: 251 GRILDLTKKGVCVLKDCAMLVMDEADKLLSAEFQPSLEELIQFLPQNRQFLMFSATFPVT 310

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   + +L     IN+   L L  +T ++
Sbjct: 311 VKAFKDRHLRKPYVINLMDQLTLMGVTQYY 340



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/84 (28%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  I+    + +     A++L PTRELA Q  QV  +      ++   
Sbjct: 171 GTGKTGAFCIPVLEKIDPNNNVIQ-----AMILVPTRELALQTSQVCKELSKYLNIQVMV 225

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   R+    L + V +++ T
Sbjct: 226 TTGGTSLRDDIMRLHQPVHLLVGT 249


>At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative 
          Length = 739

 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 37/92 (40%), Positives = 56/92 (60%), Gaps = 2/92 (2%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSA 421
           C  GRL+  +++ T N +  +   L+LDEADR+LD  F+ Q+  II Q+   RQTL++SA
Sbjct: 199 CAPGRLLQHMDE-TPNFECPQLQILILDEADRVLDSAFKGQLDPIISQLPKHRQTLLFSA 257

Query: 422 TWPKEVKKLAEDYLGDYIQINIGSLQLSAITT 517
           T  K+VK LA   L D   I++ +  ++A  T
Sbjct: 258 TQTKKVKDLARLSLRDPEYISVHAEAVTATPT 289



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 128
           GSGKTLA+++P +  ++ +      DG   ++++PTRELA Q
Sbjct: 118 GSGKTLAFVIPILEKLHRE-RWSPEDGVGCIIISPTRELAAQ 158


>At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)
           identical to GB:CAA09207, contains a DEAD/DEAH box
           family ATP-dependent helicas signature; identical to
           cDNA DEAD box RNA helicase, RH17 GI:3776008
          Length = 609

 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN-NQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT-SYVRN 176
           G+GKT+AY+ P I H+  + P + R  G  ALV+ PTREL  Q+ +      H   ++  
Sbjct: 77  GTGKTIAYLAPLIHHLQGHSPKVDRSHGTFALVIVPTRELCLQVYETLEKLLHRFHWIVP 136

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             V GG  K ++   L +G+ I+IAT
Sbjct: 137 GYVMGGEKKAKEKARLRKGISILIAT 162


>At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 671

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-----GDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           G GKTLA++LP +  + N P   +     G  P  LVL PTRELA+Q+      +G +  
Sbjct: 143 GQGKTLAFVLPILESLVNGPAKSKRKMGYGRSPSVLVLLPTRELAKQVAADFDAYGGSLG 202

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + + C++GG     Q   L+RGV+IV+ T
Sbjct: 203 LSSCCLYGGDSYPVQEGKLKRGVDIVVGT 231



 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 2/71 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR--QTLMWSATWP 430
           GR+ D +E+   +     + VLDEAD ML MGF   +  I+ ++      QTL++SAT P
Sbjct: 233 GRIKDHIERQNLDFSYLQFRVLDEADEMLRMGFVEDVELILGKVEDSTKVQTLLFSATLP 292

Query: 431 KEVKKLAEDYL 463
             VK ++  +L
Sbjct: 293 SWVKNISNRFL 303


>At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong
           similarity to RNA helicase RH25 [Arabidopsis thaliana]
           GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH31
           GI:3776030
          Length = 522

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +2

Query: 257 GRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL D +E      T L+    LVLDEAD +LDMGF   I +II  +  +RQT ++SAT 
Sbjct: 191 GRLKDHIENTPGFATRLKGVKVLVLDEADHLLDMGFRKDIERIISAVPKERQTFLFSATV 250

Query: 428 PKEVKKL 448
           P+EV+++
Sbjct: 251 PEEVRQI 257



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 32/89 (35%), Positives = 44/89 (49%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD--GPI-ALVLAPTRELAQQIQQVAADF--GHTSY 167
           G+GKT+A++LP+I  +   PP    +   PI ALV+ PTRELA Q    A      H S 
Sbjct: 101 GTGKTVAFLLPSIEVVVKSPPTSPDNKRPPILALVICPTRELANQAATEANTLLKYHPSI 160

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
                + G     EQ R      +I++AT
Sbjct: 161 GVQVVIGGTRLGLEQKRMQTNPCQILVAT 189


>At2g07750.1 68415.m01003 DEAD box RNA helicase, putative similar to
           RNA helicase RH25 [Arabidopsis thaliana] GI:3776023;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 845

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 28/69 (40%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +2

Query: 257 GRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL+D +E     T+ L      ++DEAD +LD+GF+  + KII+ +   RQ+L++SAT 
Sbjct: 513 GRLLDHIENKSGLTSRLMALKLFIVDEADLLLDLGFKRDVEKIIDCLPRQRQSLLFSATI 572

Query: 428 PKEVKKLAE 454
           PKEV+++++
Sbjct: 573 PKEVRRVSQ 581



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA----LVLAPTRELAQQI--QQVAADFGHTS 164
           G+GK++A++LPAI  +       +G   +A    L+L PTRELA QI  +  A    H  
Sbjct: 422 GTGKSMAFLLPAIETVLKAMNSGKGVHKVAPIFVLILCPTRELASQIAAEGKALLKNHDG 481

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               T + G   + +Q R      +I+IAT
Sbjct: 482 IGVQTLIGGTRFRLDQQRLESEPCQILIAT 511


>At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)
           probable replication protein A1, Oryza sativa,
           EMBL:AF009179
          Length = 456

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 34/81 (41%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRL D +   KG + L+   YLVLDEADR+L+  FE  + +I+E+I  +R+T ++SAT  
Sbjct: 148 GRLWDHMSDTKGFS-LKSLKYLVLDEADRLLNEDFEKSLNQILEEIPLERKTFLFSATMT 206

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++I   S
Sbjct: 207 KKVRKLQRACLRNPVKIEAAS 227



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-----NNQPPIRRGDGP--IALVLAPTRELAQQIQQVAADFGHT 161
           GSGKT A+ +P +  +     +++P   R   P   A VL+PTRELA QI +     G  
Sbjct: 56  GSGKTGAFAIPILQALLEYVYDSEPKKGRRPDPAFFACVLSPTRELAIQIAEQFEALGAD 115

Query: 162 SYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             +R   + GG  + +Q   L +   +++AT
Sbjct: 116 ISLRCAVLVGGIDRMQQTIALGKRPHVIVAT 146


>At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA
           helicase -Mus musculus,PIR2:I84741
          Length = 621

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-----PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKTLAY+LP IV +  +     G       P  +VL PTREL++Q+ +VA    H + 
Sbjct: 159 GSGKTLAYLLP-IVQLMREDEANLGKKTKPRRPRTVVLCPTRELSEQVYRVAKSISHHAR 217

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            R+  V GG+  R Q   L   +++V+ T
Sbjct: 218 FRSILVSGGSRIRPQEDSLNNAIDMVVGT 246



 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 8/75 (10%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP------DR--QTLM 412
           GR++  +E+G        YLVLDEAD M D GF P+IRK +  +        D+  QT++
Sbjct: 248 GRILQHIEEGNMVYGDIAYLVLDEADTMFDRGFGPEIRKFLAPLNQRALKTNDQGFQTVL 307

Query: 413 WSATWPKEVKKLAED 457
            +AT    V+KL ++
Sbjct: 308 VTATMTMAVQKLVDE 322


>At1g63250.1 68414.m07150 DEAD box RNA helicase, putative similar to
           RNA helicase (RH25) [Arabidopsis thaliana] GI:3776023;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 798

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 28/69 (40%), Positives = 46/69 (66%), Gaps = 3/69 (4%)
 Frame = +2

Query: 257 GRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL+D +E     T+ L      ++DEAD +LD+GF   + KII+ +   RQ+L++SAT 
Sbjct: 466 GRLLDHIENKSGLTSRLMALKLFIVDEADLLLDLGFRRDVEKIIDCLPRQRQSLLFSATI 525

Query: 428 PKEVKKLAE 454
           PKEV+++++
Sbjct: 526 PKEVRRVSQ 534



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI----NNQPPIRRGDGPIALVLAPTRELAQQI--QQVAADFGHTS 164
           G+GK++A++LPAI  +    N+   + +     AL+L PTRELA QI  +  A    H  
Sbjct: 375 GTGKSMAFLLPAIETVLKAMNSGKGVNKVAPIFALILCPTRELASQIAAEGKALLKFHDG 434

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               T + G   K +Q R      +I+IAT
Sbjct: 435 IGVQTLIGGTRFKLDQQRLESEPCQILIAT 464


>At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong
           similarity to RNA helicase RH26 [Arabidopsis thaliana]
           GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH26
           GI:3776024
          Length = 850

 Score = 58.0 bits (134), Expect = 5e-09
 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 3/67 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL D +E  +   T L     LVLDEAD +LDMGF   I +II  +   RQT ++SAT 
Sbjct: 519 GRLKDHIENTSGFATRLMGVKVLVLDEADHLLDMGFRRDIERIIAAVPKQRQTFLFSATV 578

Query: 428 PKEVKKL 448
           P+EV+++
Sbjct: 579 PEEVRQI 585



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 32/89 (35%), Positives = 42/89 (47%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGP---IALVLAPTRELAQQIQQVAADF--GHTSY 167
           G+GKT+A++LPAI  +   PP  R       I LV+ PTRELA Q    A      H S 
Sbjct: 429 GTGKTVAFLLPAIEAVIKSPPASRDSRQPPIIVLVVCPTRELASQAAAEANTLLKYHPSI 488

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
                + G     EQ R      +I++AT
Sbjct: 489 GVQVVIGGTKLPTEQRRMQTNPCQILVAT 517


>At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 505

 Score = 57.6 bits (133), Expect = 7e-09
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI---NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT ++++P I      +++ P  +   P+A+VLAPTREL  Q++  A   G     +
Sbjct: 157 GSGKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKGLPFK 216

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              V GG P   Q   +++GVE++I T
Sbjct: 217 TALVVGGDPMSGQLYRIQQGVELIIGT 243



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D L K T  L      VLDE D ML  GF  Q+ +I + +    Q L++SAT  +E
Sbjct: 245 GRVVDLLSKHTIELDNIMTFVLDEVDCMLQRGFRDQVMQIFQAL-SQPQVLLFSATISRE 303

Query: 437 VKKLAEDYLGDYIQINIGS 493
           V+K+      + I ++IG+
Sbjct: 304 VEKVGGSLAKEIILVSIGN 322


>At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 368

 Score = 57.6 bits (133), Expect = 7e-09
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI---NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT ++++P I      +++ P  +   P+A+VLAPTREL  Q++  A   G     +
Sbjct: 20  GSGKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKGLPFK 79

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              V GG P   Q   +++GVE++I T
Sbjct: 80  TALVVGGDPMSGQLYRIQQGVELIIGT 106



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D L K T  L      VLDE D ML  GF  Q+ +I + +    Q L++SAT  +E
Sbjct: 108 GRVVDLLSKHTIELDNIMTFVLDEVDCMLQRGFRDQVMQIFQAL-SQPQVLLFSATISRE 166

Query: 437 VKKLAEDYLGDYIQINIGS 493
           V+K+      + I ++IG+
Sbjct: 167 VEKVGGSLAKEIILVSIGN 185


>At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative similar
           to RNA helicase GI:3776027 from [Arabidopsis thaliana]
          Length = 513

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 29/84 (34%), Positives = 51/84 (60%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+++P +  +    P  +G G  AL+L+PTR+LA+Q  +   + G  + +R + 
Sbjct: 75  GSGKTAAFLIPMLEKLKQHVP--QG-GVRALILSPTRDLAEQTLKFTKELGKFTDLRVSL 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +Q  +L +G +++IAT
Sbjct: 132 LVGGDSMEDQFEELTKGPDVIIAT 155



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 257 GRLIDFL-EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+  L E     L+   Y+V DEAD +  MGF  Q+ +I+ Q+  +RQTL++SAT P 
Sbjct: 157 GRLMHLLSEVDDMTLRTVEYVVFDEADSLFGMGFAEQLHQILTQLSENRQTLLFSATLPS 216

Query: 434 EVKKLAE 454
            + + A+
Sbjct: 217 ALAEFAK 223


>At3g19760.1 68416.m02501 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative / DEAD box RNA helicase,
           putative contains DEAD/DEAH helicase domain; similar to
           RNA helicase GB:CAA09195 from [Arabidopsis thaliana];
           identical to cDNA DEAD box RNA helicase, RH2 GI:3775984
          Length = 408

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +++ +   +    L+LDE+D ML  GF+ QI  +   + PD Q  + SAT P E
Sbjct: 162 GRVCDMIKRRSLRTRAIKLLILDESDEMLSRGFKDQIYDVYRYLPPDLQVCLVSATLPHE 221

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ + ++I +    L L  I  FF
Sbjct: 222 ILEMTSKFMTEPVKILVKRDELTLEGIKQFF 252



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFG-HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           AL+L+PTRELA Q ++     G H +   + C+ GG    E  R LE GV +V  T
Sbjct: 106 ALILSPTRELATQTEKTIQAIGLHANIQAHACI-GGNSVGEDIRKLEHGVHVVSGT 160


>At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18) 
          Length = 593

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 28/78 (35%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL D +E+    + +    L+LDEADR+L+MGF+ Q+  II ++   R+T ++SAT  +
Sbjct: 151 GRLSDIMERMEILDFRNLEILILDEADRLLEMGFQRQVNYIISRLPKQRRTGLFSATQTE 210

Query: 434 EVKKLAEDYLGDYIQINI 487
            V++LA+  L + +++ +
Sbjct: 211 GVEELAKAGLRNPVRVEV 228



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 28/89 (31%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ---PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT-SYV 170
           GSGKTLA+++P +  +      PP  +    + ++++PTREL+ QI  VA  F  T + V
Sbjct: 63  GSGKTLAFVVPLVEILRRSTSFPP--KPHQVMGVIISPTRELSTQIYNVAQPFVSTLANV 120

Query: 171 RNTCVFGGAPKREQARDL-ERGVEIVIAT 254
            +  + GG   +   + + E G  ++I T
Sbjct: 121 NSVLLVGGREVKADMKIIEEEGCNVLIGT 149


>At1g51380.1 68414.m05780 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative
          Length = 392

 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 28/91 (30%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +++G+   +    LVLDE+D ML  G + QI  +   +  D Q  + SAT P+E
Sbjct: 149 GRVYDMIKRGSLQTKAVKLLVLDESDEMLSKGLKDQIYDVYRALPHDIQVCLISATLPQE 208

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++ E ++ D ++I +    L L  I  ++
Sbjct: 209 ILEMTEKFMTDPVRILVKPDELTLEGIKQYY 239



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +3

Query: 93  LVLAPTRELAQQIQQVAADFG-HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           LVL+P+RELA Q ++     G HT+   + C+ GG    E  + LERGV  V  T
Sbjct: 94  LVLSPSRELASQTEKTIQAIGAHTNIQAHACI-GGKSIGEDIKKLERGVHAVSGT 147


>At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)
           identical to cDNA DEAD box RNA helicase, RH28 GI:3776026
          Length = 789

 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query: 257 GRLIDFLEKG-TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+ID L    + +L     L+LDEADR+L  GF  +I +++      RQT+++SAT  +
Sbjct: 297 GRMIDHLRNSMSVDLDDLAVLILDEADRLLQTGFATEITELVRLCPKRRQTMLFSATMTE 356

Query: 434 EVKKLAE 454
           EVK+L +
Sbjct: 357 EVKELVK 363



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 30/84 (35%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  +  +P  +R      L+L PTRELA QI  +  +    + ++   
Sbjct: 214 GSGKTAAFALPTLERLLFRP--KRVFATRVLILTPTRELAVQIHSMIQNLAQFTDIKCGL 271

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   REQ   L    +IV+AT
Sbjct: 272 IVGGLSVREQEVVLRSMPDIVVAT 295


>At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains
           Pfam profiles  PF00270:DEAD/DEAH box helicase and
           PF00271:  Helicase conserved C-terminal domain;
           identical to cDNA RH27 helicase, partial GI:4033334
          Length = 633

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNL-QRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+D LE     + +   +LV+DEADR+L+  FE  ++KI+  +   RQT ++SAT   
Sbjct: 285 GRLLDHLENTNGFIFKNLKFLVMDEADRILEQNFEEDLKKILNLLPKTRQTSLFSATQSA 344

Query: 434 EVKKLAEDYLGDYIQINI 487
           +V+ LA   L   + I++
Sbjct: 345 KVEDLARVSLTSPVYIDV 362



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF--GHTSYVRN 176
           GSGKTLA+++PA V +  +      +G   LV+ PTRELA Q   VA +    H+  V  
Sbjct: 201 GSGKTLAFLIPA-VELLYRVKFTPRNGTGVLVICPTRELAIQSYGVAKELLKYHSQTVGK 259

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             V GG  ++ +A  L +GV +++AT
Sbjct: 260 --VIGGEKRKTEAEILAKGVNLLVAT 283


>At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical to
           RNA helicase [Arabidopsis thaliana] GI:3776023; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 563

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL D ++  +   T L     LVLDEAD +LDMGF  +I +II  +   RQT ++SAT 
Sbjct: 217 GRLKDHIDNTSGFATRLMGVKVLVLDEADHLLDMGFRREIERIIAAVPKQRQTFLFSATV 276

Query: 428 PKEVKKL 448
             EV+++
Sbjct: 277 SDEVRQI 283



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGP---IALVLAPTRELA-QQIQQVAADFGHTSYV 170
           G+GKT+A++LP+I  +   PP  R +     I LV+ PTRELA Q   +      +   +
Sbjct: 127 GTGKTVAFLLPSIEAVIKAPPASRDNRHPPIIVLVVCPTRELACQAAAEANILLKYHPSI 186

Query: 171 RNTCVFGGAPKREQARDLERG-VEIVIAT 254
               V GG     + R L++   +I++AT
Sbjct: 187 GVQVVIGGTKLPTEQRRLQKSPCQILVAT 215


>At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 781

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN---QPPIRRGDG-PIALVLAPTRELAQQIQQVAADFGHTSY- 167
           GSGKTLAY++P I  +     Q   +   G P  +VL PT ELA Q+         +   
Sbjct: 421 GSGKTLAYLVPVIQRLREEELQGHSKSSPGCPRVIVLVPTAELASQVLANCRSISKSGVP 480

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            R+  V GG  +R Q  +LE+GV+++IAT
Sbjct: 481 FRSMVVTGGFRQRTQLENLEQGVDVLIAT 509


>At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicase GB:6321111 from (S.
           cerevisiae)
          Length = 558

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 29/80 (36%), Positives = 50/80 (62%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGT-TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL D +++    + +    L+LDEADR+LDMGF+ Q+  II ++   R+T ++SAT  +
Sbjct: 151 GRLSDMMKRMEFLDFRNLEILILDEADRLLDMGFQKQVNYIISRLPKQRRTGLFSATQTQ 210

Query: 434 EVKKLAEDYLGDYIQINIGS 493
            V  LA+  L + +++  G+
Sbjct: 211 AVADLAKAGLRNAMEVISGA 230



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI---NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT-SYV 170
           GSGKTLA++LP I  I   N+ PP  +    + ++++PTREL+ QI +VA  F  T   V
Sbjct: 63  GSGKTLAFLLPFIEIIRRSNSYPP--KPHQVMGVIISPTRELSAQIHKVAEPFVSTLPNV 120

Query: 171 RNTCVFGGAPKREQARDL-ERGVEIVIAT 254
            +  + GG         L E G  ++I T
Sbjct: 121 NSVLLVGGREVEADMNTLEEEGANLLIGT 149


>At3g13920.1 68416.m01758 eukaryotic translation initiation factor
           4A-1 / eIF-4A-1 eIF-4A-1 gi:15293046, gi:15450485;
           contains Pfam profile PF00270: DEAD/DEAH box helicase;
           contains Pfam profile PF00271: Helicase conserved
           C-terminal domain
          Length = 412

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 35/118 (29%), Positives = 53/118 (44%), Gaps = 2/118 (1%)
 Frame = +2

Query: 176 HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGF 355
           H CV   S +     L  G        GR+ D L++ +         VLDEAD ML  GF
Sbjct: 139 HACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLRADNIKMFVLDEADEMLSRGF 198

Query: 356 EPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + QI  I + + P  Q  ++SAT P E  ++   ++   ++I +    L L  I  F+
Sbjct: 199 KDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFY 256



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 27/55 (49%), Positives = 33/55 (60%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           ALVLAPTRELAQQI++V    G    V+     GG   RE  R L+ GV +V+ T
Sbjct: 110 ALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGT 164


>At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar
           to gb|L13612 DEAD-box protein (dbp45A) from Drosophila
           melanogaster and is a member of PF|00270 DEAD/DEAH box
           helicase family
          Length = 491

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 24/51 (47%), Positives = 36/51 (70%)
 Frame = +2

Query: 302 RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAE 454
           R  +LVLDEADR+LD+GF+ ++R I + +   RQTL++SAT    ++ L E
Sbjct: 203 RTKFLVLDEADRVLDVGFQDELRTIFQCLPKSRQTLLFSATMTSNLQALLE 253



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 32/84 (38%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I+H   + P     G  ALV+ PTRELA Q+ +     G    +R + 
Sbjct: 105 GSGKTAAFALP-ILHRLAEDPY----GVFALVVTPTRELAFQLAEQFKALGSCLNLRCSV 159

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q   L     IVI T
Sbjct: 160 IVGGMDMLTQTMSLVSRPHIVITT 183


>At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 465

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGT-TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL D +++    + +    L+LDEADR+LDMGF+ Q+  II ++   R+T ++SAT  +
Sbjct: 144 GRLSDMMKRMEFLDFRNLEILILDEADRLLDMGFQKQVNYIISRLPKQRRTGLFSATQTQ 203

Query: 434 EVKKLAE 454
            V  LA+
Sbjct: 204 AVADLAK 210



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI---NNQPPIRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKTLA++LP I  I   N+ PP  +    + ++++PTREL+ QI +VA
Sbjct: 64  GSGKTLAFLLPFIEIIRRSNSYPP--KPHQVMGVIISPTRELSAQIHKVA 111


>At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative
           non-consensus acceptor splice site AT at exon 2; similar
           to DEAD box helicase protein GB:NP_006764 from [Homo
           sapiens], contains Pfam profile: PF00270  DEAD/DEAH box
           helicase
          Length = 568

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           GSGKTLA+++PA+ +    +   R G G   +V+ PTRELA Q + VA +         +
Sbjct: 136 GSGKTLAFLIPAVELLFKERFSPRNGTG--VIVICPTRELAIQTKNVAEELLKHHSQTVS 193

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V GG  +R +A+ +  G  +VIAT
Sbjct: 194 MVIGGNNRRSEAQRIASGSNLVIAT 218



 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           +  GS       GRL+D L+     + +    LV+DEADR+L+  FE  + KI++ +   
Sbjct: 208 IASGSNLVIATPGRLLDHLQNTKAFIYKHLKCLVIDEADRILEENFEEDMNKILKILPKT 267

Query: 398 RQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           RQT ++SAT   +VK LA   L   + +++
Sbjct: 268 RQTALFSATQTSKVKDLARVSLTSPVHVDV 297


>At1g72730.1 68414.m08410 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative similar to Eukaryotic
           initiation factor 4A-10 GB:P41382 [Nicotiana tabacum];
           identical to (putative) RNA helicase GB:CAA09211
           [Arabidopsis thaliana] (Nucleic Acids Res. 27 (2),
           628-636 (1999))
          Length = 414

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 27/55 (49%), Positives = 33/55 (60%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           ALVLAPTRELAQQI++V    G    V+     GG   RE  R L+ GV +V+ T
Sbjct: 112 ALVLAPTRELAQQIEKVMRALGDYLGVKAQACVGGTSVREDQRVLQSGVHVVVGT 166



 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L + +         VLDEAD ML  GF+ QI  I + +    Q  ++SAT P E
Sbjct: 168 GRVFDLLRRQSLRADAIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKVQVGVFSATMPPE 227

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
             ++   ++   ++I +    L L  I  F+
Sbjct: 228 ALEITRKFMNKPVRILVKRDELTLEGIKQFY 258


>At1g54270.1 68414.m06187 eukaryotic translation initiation factor
           4A-2 / eIF-4A-2 similar to eukaryotic translation
           initiation factor 4A GI:19696 from [Nicotiana
           plumbaginifolia]
          Length = 412

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 27/55 (49%), Positives = 33/55 (60%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           ALVLAPTRELAQQI++V    G    V+     GG   RE  R L+ GV +V+ T
Sbjct: 110 ALVLAPTRELAQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGT 164



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 2/118 (1%)
 Frame = +2

Query: 176 HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGF 355
           H CV   S +     L  G        GR+ D L + +         VLDEAD ML  GF
Sbjct: 139 HACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDCIKMFVLDEADEMLSRGF 198

Query: 356 EPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + QI  I + + P  Q  ++SAT P E  ++   ++   ++I +    L L  I  F+
Sbjct: 199 KDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFY 256


>At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative
          Length = 427

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 20/78 (25%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++    +   +L+   + +LDE D+ML+ +     +++I +    D+Q +M+SAT  K
Sbjct: 175 GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK 234

Query: 434 EVKKLAEDYLGDYIQINI 487
           E++ + + ++ D ++I +
Sbjct: 235 EIRPVCKKFMQDPMEIYV 252



 Score = 27.9 bits (59), Expect = 6.6
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQI 131
           G GKT  ++L  +  I   P      G + ALVL  TRELA QI
Sbjct: 93  GMGKTAVFVLSTLQQIEPSP------GQVSALVLCHTRELAYQI 130


>At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 344

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 20/78 (25%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++    +   +L+   + +LDE D+ML+ +     +++I +    D+Q +M+SAT  K
Sbjct: 92  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK 151

Query: 434 EVKKLAEDYLGDYIQINI 487
           E++ + + ++ D ++I +
Sbjct: 152 EIRPVCKKFMQDPMEIYV 169



 Score = 27.9 bits (59), Expect = 6.6
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQI 131
           G GKT  ++L  +  I   P      G + ALVL  TRELA QI
Sbjct: 10  GMGKTAVFVLSTLQQIEPSP------GQVSALVLCHTRELAYQI 47


>At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 427

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 20/78 (25%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++    +   +L+   + +LDE D+ML+ +     +++I +    D+Q +M+SAT  K
Sbjct: 175 GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK 234

Query: 434 EVKKLAEDYLGDYIQINI 487
           E++ + + ++ D ++I +
Sbjct: 235 EIRPVCKKFMQDPMEIYV 252



 Score = 27.9 bits (59), Expect = 6.6
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQI 131
           G GKT  ++L  +  I   P      G + ALVL  TRELA QI
Sbjct: 93  GMGKTAVFVLSTLQQIEPSP------GQVSALVLCHTRELAYQI 130


>At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative similar
           to RNA helicase involved in rRNA processing GB:6321267
           from [Saccharomyces cerevisiae]c, ontains DEAD and DEAH
           box domain
          Length = 541

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-RPDRQTLMWSATWPKEVKKLAEDYLGD 469
           +L +  YLVLDE+D++ +     QI  +++    P     ++SAT P  V++LA   + D
Sbjct: 279 DLSKVEYLVLDESDKLFEQSLLKQIDCVVKACSNPSIIRSLFSATLPDSVEELARSIMHD 338

Query: 470 YIQINIGSLQLSAITTFFKL 529
            +++ IG    ++ T   KL
Sbjct: 339 AVRVIIGRKNTASETVKQKL 358



 Score = 34.7 bits (76), Expect = 0.057
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 128
           GSGKT A+I P ++ +         DG  A++L+P RELA Q
Sbjct: 188 GSGKTFAFICPMLIKLKRPST----DGIRAVILSPARELAAQ 225


>At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /
           pentatricopeptide (PPR) repeat-containing protein
           contains Pfam profiles:  PF00271 helicase conserved
           C-terminal domain, PF01535 PPR repeat, PF00270:
           DEAD/DEAH box helicase
          Length = 1145

 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 14/82 (17%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--------------RP 394
           GR+ +  + G  +   C +LVLDE D +L   F   I +I+E +              R 
Sbjct: 252 GRIAEISKGGKLHTHGCRFLVLDEVDELLSFNFREDIHRILEHVGKRSGAGPKGEVDERA 311

Query: 395 DRQTLMWSATWPKEVKKLAEDY 460
           +RQT++ SAT P  V + A+ +
Sbjct: 312 NRQTILVSATVPFSVIRAAKSW 333



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 9/91 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGP--------IALVLAPTRELAQQI-QQVAADFG 155
           GSGKTLAY+LP +  I       R             A+++AP+REL  QI ++V    G
Sbjct: 157 GSGKTLAYLLPILSEIGPLAEKSRSSHSENDKRTEIQAMIVAPSRELGMQIVREVEKLLG 216

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVI 248
                    + GGA +  Q   L++    ++
Sbjct: 217 PVHRRMVQQLVGGANRMRQEEALKKNKPAIV 247


>At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)
           identical to cDNA DEAD box RNA helicase, RH16 GI:3776006
          Length = 626

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-RRGDGPIALVLAPTRELAQQI 131
           GSGKTLAY+LP +  + +   + ++   P A +L P+REL QQ+
Sbjct: 93  GSGKTLAYLLPLLQKLFSADSVSKKKLAPSAFILVPSRELCQQV 136



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 22/58 (37%), Positives = 33/58 (56%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           LVLDEAD +L  G+E  +R +   I    Q L+ SAT   +V+KL +  L + I + +
Sbjct: 204 LVLDEADLLLSYGYEDNLRSVTSIIPRRCQCLLMSATTSSDVEKLKKLILHNPIVLTL 261


>At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)
           similar to RNA helicase GB:CAA09204 from [Arabidopsis
           thaliana]; identical to cDNA DEAD box RNA helicase, RH13
           GI:3776002
          Length = 832

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 15/99 (15%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI--------------NNQPPIRRGDGPI-ALVLAPTRELAQQIQQ 137
           GSGKTLA+ LP +  +                +      DG + AL++ PTRELA Q+ +
Sbjct: 238 GSGKTLAFGLPILQRLLDEREKVGKLYALKGEEAQKYAADGYLRALIITPTRELALQVTE 297

Query: 138 VAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
              +      V+   + GG    +Q R L+   EIV+AT
Sbjct: 298 HLENAAKNLSVKVVPIVGGMFSEKQERRLKEKPEIVVAT 336



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
 Frame = +2

Query: 257 GRLIDFL---EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE 382
           GRL + +   EK    L   ++ VLDEADRM++ G   +++ I++
Sbjct: 338 GRLWELMSAGEKHLVELHSLSFFVLDEADRMVERGHFRELQSILD 382


>At4g15850.1 68417.m02410 DEAD/DEAH box helicase, putative similar
           to D-E-A-D box protein [Drosophila melanogaster]
           GI:499204; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 512

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 23/46 (50%), Positives = 30/46 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQV 140
           GSGKTL+Y LP IV +    P+R      ALV+ PTR+LA Q++ V
Sbjct: 72  GSGKTLSYALP-IVQLLASRPVR---CLRALVVLPTRDLALQVKDV 113



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL+D +   KG T L+   YLV+DE DR+L   ++  +  +++  +    +L  S T
Sbjct: 174 GRLMDHINNTKGFT-LEHLRYLVVDETDRLLREAYQSWLPTVLQLTQTSDDSLFPSFT 230


>At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA
           helicase, Mus musculus, PIR:I49731
          Length = 496

 Score = 34.3 bits (75), Expect = 0.076
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           GSGKT  ++L  +  ++  P +R    P AL + PTRELA Q  +V    G
Sbjct: 141 GSGKTTCFVLGMLSRVD--PTLRE---PQALCICPTRELANQNMEVLQKMG 186


>At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative
           EUKARYOTIC INITIATION FACTOR 4A-II (EIF-4A-II), Homo
           sapiens, SWISSPROT:IF42_HUMAN
          Length = 472

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKTL Y+L     IN Q    +     A+++ PTREL  Q+ +VA
Sbjct: 123 GSGKTLTYLLLIFSLINPQRSSVQ-----AVIVVPTRELGMQVTKVA 164


>At1g59990.1 68414.m06758 DEAD/DEAH box helicase, putative (RH22)
           similar to RNA helicase GI:3776015 from [Arabidopsis
           thaliana]; contains Pfam profiles PF00271: Helicase
           conserved C-terminal domain, PF00270: DEAD/DEAH box
           helicase; matches EST OAO811-2
          Length = 581

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +2

Query: 302 RCT-YLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQ 478
           RC  Y+V DEAD +L   F+ QI ++I  +R D           K+V +LA+  LG  ++
Sbjct: 236 RCVKYVVFDEADMLLCGSFQNQIIRLINMLRFDE----------KQVSRLAKSNLGRPME 285

Query: 479 INIGSLQL 502
           I+    Q+
Sbjct: 286 IDASVPQI 293


>At1g71390.1 68414.m08243 disease resistance family protein / LRR
           family protein contains leucine rich-repeat domains
           Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5B
           [Lycopersicon esculentum] gi|3894391|gb|AAC78595
          Length = 784

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = -2

Query: 305 TAVSWLCPFPRNQLIYLSSNDYFYSPLQVPGL 210
           T  SWL   P  Q++ L SND FY PL  P +
Sbjct: 496 TFPSWLGSLPSLQVLILRSND-FYGPLYHPSM 526


>At2g28600.1 68415.m03476 expressed protein 
          Length = 502

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/69 (18%), Positives = 34/69 (49%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEV 439
           RL++ +     ++   + LV+DE   +   G+   ++ I + I    QT++++ ++   +
Sbjct: 256 RLLEIVTLKGVDISNVSLLVIDELGSLCSGGYLNAVKSIKQAISSKHQTIVFNNSFSASI 315

Query: 440 KKLAEDYLG 466
               + +LG
Sbjct: 316 IPAVQSFLG 324


>At5g62370.1 68418.m07828 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 982

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +2

Query: 233 SRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEP 361
           SRN HCY+  +  F +KG   + +   L++    RMLD G  P
Sbjct: 375 SRNVHCYTNLIFGFYKKG--GMDKAVDLLM----RMLDNGIVP 411


>At4g13920.1 68417.m02154 disease resistance family protein / LRR
           family protein contains leucine rich-repeat domains
           Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2
           [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780
          Length = 891

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = -2

Query: 305 TAVSWLCPFPRNQLIYLSSNDYFYSPLQVPG-LLSF 201
           T  SWL   P  QL+ L SN+ F+ P+  PG  LSF
Sbjct: 607 TFPSWLKSLPNLQLLVLRSNE-FHGPIFSPGDSLSF 641


>At4g13810.1 68417.m02140 disease resistance family protein / LRR
           family protein contains leucine rich-repeat domains
           Pfam:PF00560, INTERPRO:IPR001611; similar to disease
           resistance protein [Lycopersicon esculentum]
           gi|3894383|gb|AAC78591
          Length = 741

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = -2

Query: 305 TAVSWLCPFPRNQLIYLSSNDYFYSPLQVPG-LLSF 201
           T  SWL   P  Q++ L SN+ FY P+  PG  LSF
Sbjct: 457 TFPSWLELLPNLQILVLRSNE-FYGPIFSPGDSLSF 491


>At3g60970.1 68416.m06823 ABC transporter family protein ABC
            transporter-like proteins
          Length = 1037

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +2

Query: 284  GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
            G   L++   LVLDEA   +D   +  I+KII Q   DR
Sbjct: 934  GRVLLKKSNILVLDEATASVDSATDGVIQKIINQEFKDR 972


>At3g60160.1 68416.m06717 ABC transporter family protein similar to
            ATP-binding cassette transporter MRP8 GI:18031899 from
            [Arabidopsis thaliana]
          Length = 1490

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +2

Query: 284  GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
            G   L++   LVLDEA   +D   +  I+KII Q   DR
Sbjct: 1387 GRVLLKKSNILVLDEATASVDSATDGVIQKIINQEFKDR 1425


>At3g04670.1 68416.m00500 WRKY family transcription factor similar
           to elicitor response element binding protein WRKY3
           isolog GB:AAB63078 [Arabidopsis thaliana]
          Length = 330

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 130 ICCANSLVGAKTKAIGPSPLRI 65
           ICC N L G  T+ + P PL++
Sbjct: 79  ICCGNDLSGDYTQVLAPEPLQM 100


>At1g15820.1 68414.m01898 chlorophyll A-B binding protein,
           chloroplast (LHCB6) nearly identical to Lhcb6 protein
           [Arabidopsis thaliana] GI:4741960; contains Pfam profile
           PF00504: Chlorophyll A-B binding protein
          Length = 258

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/45 (28%), Positives = 26/45 (57%)
 Frame = +2

Query: 335 RMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGD 469
           ++L MG+  + ++ ++   PD Q++ W+  W K  +  A +Y GD
Sbjct: 149 QLLLMGWV-ESKRWVDFFNPDSQSVEWATPWSKTAENFA-NYTGD 191


>At5g27300.1 68418.m03260 pentatricopeptide (PPR) repeat-containing
           protein low similarity to fertility restorer [Petunia x
           hybrida] GI:22128587; contains Pfam profile PF01535: PPR
           repeat
          Length = 510

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +2

Query: 254 SGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQI 367
           +GR++DF+   T   + C     DEA R+L+M  E Q+
Sbjct: 307 NGRVVDFISYRTLVDESCRKGKYDEATRLLEMLREKQL 344


>At2g27800.1 68415.m03370 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 427

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +2

Query: 254 SGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQI 367
           +GR++DF+   T   + C     DEA R+L+M  E Q+
Sbjct: 373 NGRVVDFISYRTLVDESCRKGKYDEATRLLEMLREKQL 410


>At2g33670.1 68415.m04126 seven transmembrane MLO family protein /
           MLO-like protein 5 (MLO5) identical to MLO-like protein
           5 (AtMlo5) [Arabidopsis thaliana] SWISS-PROT:O22815;
           similar to MLO protein SWISS-PROT:P93766,
           NCBI_gi:1877221 [Hordeum vulgare][Barley]
          Length = 501

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = -3

Query: 613 LHQVLDFVQFLAIIHLIY 560
           LHQV  F+ FLA+ H+IY
Sbjct: 147 LHQVHIFIFFLAVFHVIY 164


>At1g42560.1 68414.m04907 seven transmembrane MLO family protein /
           MLO-like protein 9 (MLO9) nearly identical to membrane
           protein Mlo9 [Arabidopsis thaliana] GI:14091588; similar
           to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221
           [Hordeum vulgare][Barley]
          Length = 467

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = -3

Query: 613 LHQVLDFVQFLAIIHLIY 560
           LHQV  F+ FLA+ H+IY
Sbjct: 154 LHQVHIFIFFLAVFHVIY 171


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,197,439
Number of Sequences: 28952
Number of extensions: 318990
Number of successful extensions: 1098
Number of sequences better than 10.0: 77
Number of HSP's better than 10.0 without gapping: 941
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1049
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1438152744
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -