SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g26150.1 68418.m03110 protein kinase family protein contains ...    34   0.096
At5g12000.1 68418.m01403 protein kinase family protein contains ...    34   0.096
At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila...    33   0.17 
At2g17540.2 68415.m02030 expressed protein                             31   0.51 
At2g17540.1 68415.m02029 expressed protein                             31   0.51 
At5g16730.1 68418.m01959 expressed protein weak similarity to mi...    31   0.90 
At2g07020.1 68415.m00803 protein kinase family protein contains ...    29   2.7  
At1g16760.1 68414.m02013 protein kinase family protein contains ...    29   2.7  
At2g30940.2 68415.m03773 protein kinase family protein contains ...    29   3.6  
At2g30940.1 68415.m03772 protein kinase family protein contains ...    29   3.6  
At1g78940.1 68414.m09203 protein kinase family protein contains ...    29   3.6  
At5g66350.1 68418.m08365 zinc finger protein, putative (SHI) sim...    28   4.8  
At4g31230.1 68417.m04433 protein kinase family protein contains ...    28   4.8  
At3g20200.1 68416.m02560 protein kinase family protein contains ...    28   6.3  
At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding protei...    28   6.3  
At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE) i...    28   6.3  
At1g80000.2 68414.m09359 expressed protein identical to unknown ...    28   6.3  
At1g80000.1 68414.m09358 expressed protein identical to unknown ...    28   6.3  
At5g24810.1 68418.m02930 ABC1 family protein contains Pfam domai...    27   8.4  
At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ...    27   8.4  
At3g01900.1 68416.m00137 cytochrome P450 family protein similar ...    27   8.4  

>At5g26150.1 68418.m03110 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 703

 Score = 33.9 bits (74), Expect = 0.096
 Identities = 17/35 (48%), Positives = 22/35 (62%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA ALS +HQ   E    RDL+PA + L+ N +
Sbjct: 523 AEIATALSFLHQAKPEPLVHRDLKPANILLDKNYV 557


>At5g12000.1 68418.m01403 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 703

 Score = 33.9 bits (74), Expect = 0.096
 Identities = 17/35 (48%), Positives = 22/35 (62%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA ALS +HQ   E    RDL+PA + L+ N +
Sbjct: 523 AEIATALSFLHQAKPEPLVHRDLKPANILLDKNYV 557


>At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar
           to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana
           sylvestris]; contains Pfam profile: PF00076 RNA
           recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 245

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 21/57 (36%), Positives = 24/57 (42%), Gaps = 1/57 (1%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPG-RHHGGDEDRVRLP 202
           RYS  DD+ S +D R    DG       +R     GGR R  G R   G E   R P
Sbjct: 179 RYSSKDDRYSSKDDRYGSRDGGGSRYGPDRSGERAGGRSRDGGSRGAPGGERHSRAP 235


>At2g17540.2 68415.m02030 expressed protein 
          Length = 275

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = +2

Query: 212 SPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKA 391
           SP F   +    +S     S + H H+ +HL+  Q +  + L   AS+++A    ++AKA
Sbjct: 36  SPPFASSSSSTTTSNGSSASAVVHTHHLDHLLNDQTRSPEEL-AQASKATAALAVKVAKA 94


>At2g17540.1 68415.m02029 expressed protein 
          Length = 275

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = +2

Query: 212 SPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKA 391
           SP F   +    +S     S + H H+ +HL+  Q +  + L   AS+++A    ++AKA
Sbjct: 36  SPPFASSSSSTTTSNGSSASAVVHTHHLDHLLNDQTRSPEEL-AQASKATAALAVKVAKA 94


>At5g16730.1 68418.m01959 expressed protein weak similarity to
           microtubule binding protein D-CLIP-190 [Drosophila
           melanogaster] GI:2773363, SMC2-like condensin
           [Arabidopsis thaliana] GI:14279543
          Length = 853

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = +2

Query: 218 KFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSA--KSDAEIA-K 388
           K E  A     S  KQ   +E  +++ H  ET++ DLK  IVT   + A  K D E++ +
Sbjct: 338 KLERSASVSLESVMKQ---LEGSNDKLHDTETEITDLKERIVTLETTVAKQKEDLEVSEQ 394

Query: 389 ALSVVHQDLDEADKDRDLEPAKVSLE 466
            L  V +++ + +K  ++E  K  LE
Sbjct: 395 RLGSVEEEVSKNEK--EVEKLKSELE 418


>At2g07020.1 68415.m00803 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 700

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA +L+ +HQ   E    RDL+PA + L+ + +
Sbjct: 520 AEIATSLNFLHQLKPEPLVHRDLKPANILLDQHMV 554


>At1g16760.1 68414.m02013 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 758

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA  L  +HQ   E    RDL+P  V L+ N +
Sbjct: 551 AEIATGLLFLHQTKPEPIVHRDLKPGNVLLDHNYV 585


>At2g30940.2 68415.m03773 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 447

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = +2

Query: 380 IAKALSVVHQDLDEADKDRDLEPAKVSLE 466
           +AK L+ +H+D++     +D+ P+K+ L+
Sbjct: 274 VAKGLAYIHEDIEPKITHQDIRPSKILLD 302


>At2g30940.1 68415.m03772 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 445

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = +2

Query: 380 IAKALSVVHQDLDEADKDRDLEPAKVSLE 466
           +AK L+ +H+D++     +D+ P+K+ L+
Sbjct: 274 VAKGLAYIHEDIEPKITHQDIRPSKILLD 302


>At1g78940.1 68414.m09203 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 680

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA  L  +HQ   E    RDL+P  V L+ N +
Sbjct: 478 AEIATGLLFLHQTKPEPIVHRDLKPGNVLLDYNYV 512


>At5g66350.1 68418.m08365 zinc finger protein, putative (SHI)
           similar to lateral root primordium 1 (LRP1) [Arabidopsis
           thaliana] GI:882341; contains Pfam profile PF05142:
           Domain of unknown function (DUF702); identical to cDNA
           putative zinc finger protein SHI (SHI)  GI:4929802
          Length = 331

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = +2

Query: 212 SPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRL 337
           +P    D GE   S+     L +H +NQE + + Q +  +RL
Sbjct: 39  NPNSNADGGEAGPSYKGTLELWQHPNNQEIIFQQQQQQQQRL 80


>At4g31230.1 68417.m04433 protein kinase family protein contains
           Pfam profiles PF00069: Protein kinase domain, PF00582:
           universal stress protein family
          Length = 764

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = +2

Query: 353 QSSAKSDAEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI--LTGIGI 496
           Q+  +  AEI   L  +HQ   E    RDL+PA + L+ N +  L  +G+
Sbjct: 561 QTRFRIAAEIGTVLLFLHQTKPEPLVHRDLKPANILLDRNFVSKLADVGL 610


>At3g20200.1 68416.m02560 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 780

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AE+A  L  +HQ   E    RDL+P  + ++ N +
Sbjct: 554 AEVATGLLFLHQTKPEPIVHRDLKPGNILIDQNYV 588


>At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding
           protein-related similar to matrix-localized MAR DNA
           binding protein MFP1 GI:1771158 from [Lycopersicon
           esculentum]
          Length = 726

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 20/95 (21%), Positives = 45/95 (47%)
 Frame = +2

Query: 182 EDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSS 361
           +D++     +  K   D    ++   ++  L+E + ++ +L+  ++KD +      + S 
Sbjct: 233 KDQIESLENSLSKAGEDKEALETKLREKLDLVEGLQDRINLLSLELKDSEEKAQRFNASL 292

Query: 362 AKSDAEIAKALSVVHQDLDEADKDRDLEPAKVSLE 466
           AK +AE+ +  S+  Q        RDL  AK+ ++
Sbjct: 293 AKKEAELKELNSIYTQ------TSRDLAEAKLEIK 321


>At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE)
           identical to C2H2 zinc-finger protein SERRATE
           GI:14486602 from [Arabidopsis thaliana]
          Length = 720

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/45 (37%), Positives = 21/45 (46%)
 Frame = +2

Query: 56  KQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
           ++SP   R +  D   DG  R  P    G  DR+ G  HGG  DR
Sbjct: 107 RRSPPQKRYRRDDNGYDG-RRGSPRGGYGPPDRRFGYDHGGGYDR 150



 Score = 27.9 bits (59), Expect = 6.3
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHG-GDE 184
           RY R D+     DGR     G    P+R     H GG DR+ G   G GDE
Sbjct: 114 RYRRDDNGY---DGRRGSPRGGYGPPDRRFGYDHGGGYDREMGGRPGYGDE 161


>At1g80000.2 68414.m09359 expressed protein identical to unknown
           protein GB:AAD55481 [Arabidopsis thaliana]
          Length = 605

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +2

Query: 71  DGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKF 223
           D R  GHD   +   +++    R  R R  GR  G  +DR +  G  S +F
Sbjct: 169 DERKWGHDKFEEMNTQKQQYDRRTSRGRGRGRGQGRGQDRGQSRGNNSKEF 219


>At1g80000.1 68414.m09358 expressed protein identical to unknown
           protein GB:AAD55481 [Arabidopsis thaliana]
          Length = 605

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +2

Query: 71  DGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKF 223
           D R  GHD   +   +++    R  R R  GR  G  +DR +  G  S +F
Sbjct: 169 DERKWGHDKFEEMNTQKQQYDRRTSRGRGRGRGQGRGQDRGQSRGNNSKEF 219


>At5g24810.1 68418.m02930 ABC1 family protein contains Pfam domain,
           PF03109: ABC1 family
          Length = 1009

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +3

Query: 132 TIAGGGTASRADITEAMKTEFAYQEQLAQNLKLMQENI 245
           ++AG    S    +EAMKT     +Q  QN+K++QE +
Sbjct: 407 SVAGLFFRSSTPSSEAMKTFKTLNDQRVQNMKVIQEKM 444


>At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing
           protein low similarity to glycine-rich RNA-binding
           protein [Euphorbia esula] GI:2645699; contains
           INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA
           recognition motif) (RRM) domain
          Length = 337

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 19/73 (26%), Positives = 29/73 (39%)
 Frame = +2

Query: 107 GPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHM 286
           GP R +P    GG DR P R   G+ +R R    +  +           + ++    EH 
Sbjct: 92  GPGRLQP---HGGWDRSPDRRSDGNYERDRYSDRSRERDRSQDRRKDHRYIEKERAYEHS 148

Query: 287 HNQEHLVETQMKD 325
           H+ E   +  M D
Sbjct: 149 HDFERRNDHDMVD 161


>At3g01900.1 68416.m00137 cytochrome P450 family protein similar to
           Cytochrome P450 94A1  (P450-dependent fatty acid
           omega-hydroxylase) (SP:O81117) {Vicia sativa}; contains
           Pfam profile: PF00067 cytochrome P450
          Length = 496

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 368 SDAEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQILTG 487
           S+ E+ KA+  VH  +DE  +D+  +PA        I+ G
Sbjct: 236 SEKELRKAVGEVHNCVDEIIRDKKRKPANQDFLSRLIVAG 275


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,832,494
Number of Sequences: 28952
Number of extensions: 291802
Number of successful extensions: 1120
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1064
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1115
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -