SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g42740.1 68415.m05293 60S ribosomal protein L11 (RPL11A)           130   1e-30
At5g45775.2 68418.m05629 60S ribosomal protein L11 (RPL11D)           129   2e-30
At5g45775.1 68418.m05628 60S ribosomal protein L11 (RPL11D)           129   2e-30
At4g18730.1 68417.m02768 60S ribosomal protein L11 (RPL11C)           129   2e-30
At3g58700.1 68416.m06542 60S ribosomal protein L11 (RPL11B) ribo...   129   2e-30
At4g01310.1 68417.m00171 ribosomal protein L5 family protein con...    38   0.004
At1g04840.1 68414.m00480 pentatricopeptide (PPR) repeat-containi...    37   0.012
At4g30990.1 68417.m04398 expressed protein ; expression supporte...    29   1.9  
At3g13880.1 68416.m01754 pentatricopeptide (PPR) repeat-containi...    29   2.5  
At3g06210.1 68416.m00714 expressed protein contains Prosite PS00...    29   3.3  
At4g14280.1 68417.m02201 hypothetical protein                          28   5.7  
At2g16950.1 68415.m01953 importin beta-2 subunit family protein ...    28   5.7  
At2g31990.1 68415.m03908 exostosin family protein contains Pfam ...    27   10.0 

>At2g42740.1 68415.m05293 60S ribosomal protein L11 (RPL11A)
          Length = 172

 Score =  130 bits (313), Expect = 1e-30
 Identities = 60/83 (72%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RP
Sbjct: 67  KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERP 126

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TK+
Sbjct: 127 GYRVARRRRCKARVGIQHRVTKD 149



 Score =  106 bits (255), Expect = 1e-23
 Identities = 53/72 (73%), Positives = 61/72 (84%)
 Frame = +2

Query: 62  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 241
           MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA +
Sbjct: 1   MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY 60

Query: 242 CTVRELKQKKSL 277
            TVR  K  + L
Sbjct: 61  VTVRGEKAMQLL 72



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 141 GIQHRVTKDDAMKWFQVKYEG 161


>At5g45775.2 68418.m05629 60S ribosomal protein L11 (RPL11D) 
          Length = 182

 Score =  129 bits (311), Expect = 2e-30
 Identities = 60/83 (72%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RP
Sbjct: 77  KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERP 136

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TK+
Sbjct: 137 GYRVARRRRCKTRVGIQHRVTKD 159



 Score =  110 bits (265), Expect = 6e-25
 Identities = 56/80 (70%), Positives = 64/80 (80%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 3   SEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 62

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 63  RNEKIACYVTVRGEKAMQLL 82



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 151 GIQHRVTKDDAMKWFQVKYEG 171


>At5g45775.1 68418.m05628 60S ribosomal protein L11 (RPL11D) 
          Length = 172

 Score =  129 bits (311), Expect = 2e-30
 Identities = 60/83 (72%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RP
Sbjct: 67  KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERP 126

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TK+
Sbjct: 127 GYRVARRRRCKTRVGIQHRVTKD 149



 Score =  106 bits (255), Expect = 1e-23
 Identities = 53/72 (73%), Positives = 61/72 (84%)
 Frame = +2

Query: 62  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 241
           MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA +
Sbjct: 1   MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY 60

Query: 242 CTVRELKQKKSL 277
            TVR  K  + L
Sbjct: 61  VTVRGEKAMQLL 72



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 141 GIQHRVTKDDAMKWFQVKYEG 161


>At4g18730.1 68417.m02768 60S ribosomal protein L11 (RPL11C)
          Length = 182

 Score =  129 bits (311), Expect = 2e-30
 Identities = 60/83 (72%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RP
Sbjct: 77  KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERP 136

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TK+
Sbjct: 137 GYRVARRRRCKTRVGIQHRVTKD 159



 Score =  110 bits (265), Expect = 6e-25
 Identities = 56/80 (70%), Positives = 64/80 (80%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 3   SEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 62

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 63  RNEKIACYVTVRGEKAMQLL 82



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 151 GIQHRVTKDDAMKWFQVKYEG 171


>At3g58700.1 68416.m06542 60S ribosomal protein L11 (RPL11B)
           ribosomal protein L11, cytosolic, Arabidopsis thaliana,
           PIR:S49033
          Length = 182

 Score =  129 bits (311), Expect = 2e-30
 Identities = 60/83 (72%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RP
Sbjct: 77  KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERP 136

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TK+
Sbjct: 137 GYRVARRRRCKTRVGIQHRVTKD 159



 Score =  110 bits (265), Expect = 6e-25
 Identities = 56/80 (70%), Positives = 64/80 (80%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 3   SEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 62

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 63  RNEKIACYVTVRGEKAMQLL 82



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 151 GIQHRVTKDDAMKWFQVKYEG 171


>At4g01310.1 68417.m00171 ribosomal protein L5 family protein
           contains Pfam profiles PF00673: ribosomal L5P family
           C-terminus, PF00281: ribosomal protein L5
          Length = 262

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 18/69 (26%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGESGDR---LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE 226
           N+ +   ++K+ +N  +G++      L  A K +  +TGQ+P+ ++AR ++ +F IR ++
Sbjct: 79  NIHQVPKVQKIVVNCGIGDAAQNDKGLEAAMKDIALITGQKPIKTRARASIATFKIREDQ 138

Query: 227 KIAVHCTVR 253
            + +  T+R
Sbjct: 139 PLGIAVTLR 147


>At1g04840.1 68414.m00480 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 665

 Score = 36.7 bits (81), Expect = 0.012
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 5/60 (8%)
 Frame = +1

Query: 268 EILERGLKVREYELRR--DNFSATGNFGFGIQEH---IDLGIKYDPSIGIYGLDFYVVLG 432
           E+LE+GLK  EY +       S +G  G GI+ H   +D GIK D +IG   +D Y   G
Sbjct: 283 EMLEKGLKPNEYTIAAVLSACSKSGALGSGIRIHGYILDNGIKLDRAIGTALVDMYAKCG 342


>At4g30990.1 68417.m04398 expressed protein ; expression supported
           by MPSS
          Length = 2138

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 5/62 (8%)
 Frame = -2

Query: 241 MDSNLFIT-TDTKRPHCIPSLGKYRLLSCELLQHLGGTS----QPVTGFTNTDVQAKLSD 77
           +DS+L I    T R H   S GKY+L+    L  L GT+      +TG  ++D++  LS 
Sbjct: 465 VDSSLLICFKKTLRQHLAVSDGKYQLMIHSFLHSLLGTTLRSCYKMTGINHSDLEEALSF 524

Query: 76  MK 71
            K
Sbjct: 525 AK 526


>At3g13880.1 68416.m01754 pentatricopeptide (PPR) repeat-containing
           protein contains INTERPRO:IPR002885 PPR repeats
          Length = 748

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +1

Query: 244 YSPRAKAEEILERGLKVREYELRRDNFSATGNFGF-GIQEHIDLGIKYDPSIGIYGLDFY 420
           Y+     E+ +E  L+ RE  L+ D F+  G  GF G +  +DLG      + + GL   
Sbjct: 123 YTQMGFYEQAMELFLEAREANLKLDKFTYAGALGFCGERCDLDLGELLHGLVVVNGLSQQ 182

Query: 421 VVL 429
           V L
Sbjct: 183 VFL 185


>At3g06210.1 68416.m00714 expressed protein contains Prosite
           PS00616: Histidine acid phosphatases phosphohistidine
           signature;
          Length = 840

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 19/89 (21%), Positives = 41/89 (46%), Gaps = 2/89 (2%)
 Frame = +2

Query: 182 KARYTVRSFGIRRNEKIAVHCTVRELKQKKSLRGV*KSENMNCGVTTSPPRVILASVF-- 355
           +A +TV   GI  + ++    ++  L+  K +        ++ G+  +  R+    +F  
Sbjct: 140 QATWTVSGVGIS-SFRVLQSSSISLLRNLKRISDGIFKPILDNGLREATTRIGRQEIFDR 198

Query: 356 KNTLTWVSSTIPQLEFMDWTFTSYLAGQV 442
           + TLTW +S +P L +  W + S    ++
Sbjct: 199 RTTLTWKNSEVPLLPYARWLYISSYVSRI 227


>At4g14280.1 68417.m02201 hypothetical protein
          Length = 798

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +2

Query: 362 TLTWVSSTIPQLEFMDWTFTS 424
           T TW SS +P L +  W F S
Sbjct: 167 TRTWKSSDVPMLPYTGWVFVS 187


>At2g16950.1 68415.m01953 importin beta-2 subunit family protein
           similar to SP|Q92973 Importin beta-2 subunit
           (Transportin) {Homo sapiens}; contains Pfam profile
           PF03810: Importin-beta N-terminal domain
          Length = 891

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 14/53 (26%), Positives = 27/53 (50%)
 Frame = +2

Query: 32  EGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKAR 190
           EG     +++++  ++R L LN C+ E+ D    A  ++  L    PV+ + R
Sbjct: 650 EGLGSGIESLVQQSNLRDLLLNCCIDEAADVRQSAFALMGDLARVFPVYLQPR 702


>At2g31990.1 68415.m03908 exostosin family protein contains Pfam
           profile: PF03016 Exostosin family
          Length = 479

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%)
 Frame = +2

Query: 101 CVGESGDRLTRAAKVLEQLTGQQPVF--SKARYTVRSFGIRRN-EKIAVHCTVRELK 262
           C+   GD LTR +     L G  PVF    + Y    + I +N  K +V+ TV+EL+
Sbjct: 349 CLQPPGDSLTRKSVFDSILAGCIPVFFNQGSAYKQYLWHIPKNSSKYSVYITVKELR 405


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,608,507
Number of Sequences: 28952
Number of extensions: 273726
Number of successful extensions: 773
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 748
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 772
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1246162608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -