SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ...    30   1.5  
At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ...    30   1.5  
At3g23270.1 68416.m02933 regulator of chromosome condensation (R...    29   2.7  
At2g36400.1 68415.m04467 expressed protein nearly identical to t...    29   3.5  
At1g58025.1 68414.m06576 DNA-binding bromodomain-containing prot...    28   4.7  

>At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative
           (UBP27) similar to GI:11993494; ubiquitin specific
           protease 66 - Gallus gallus,PID:g3800764
          Length = 361

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +3

Query: 357 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 479
           R ++ + T+Y + FNL S   A + + HLI + +E + V+C
Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186


>At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative
           (UBP27) similar to GI:11993494; ubiquitin specific
           protease 66 - Gallus gallus,PID:g3800764
          Length = 494

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +3

Query: 357 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 479
           R ++ + T+Y + FNL S   A + + HLI + +E + V+C
Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186


>At3g23270.1 68416.m02933 regulator of chromosome condensation
           (RCC1) family protein contains Pfam domain PF00415:
           Regulator of chromosome condensation (RCC1); similar to
           zinc finger protein (GI:15811367) [Arabidopsis
           thaliana]; similar to chromosome condensation regulator
           protein (GI:22770461) [Cicer arietinum]
          Length = 1045

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)
 Frame = +3

Query: 417 QAEQLIFHLIYNNEE-AVNVICDNLKYTEVFTAA 515
           + + L F L+YNN E ++++IC +   TEV+ AA
Sbjct: 82  EKDHLSFSLLYNNRERSLDLICKDKAETEVWFAA 115


>At2g36400.1 68415.m04467 expressed protein nearly identical to
           transcription activator GRL3 [Arabidopsis thaliana]
           GI:21539884 (unpublished); supporting cDNA
           gi|21539883|gb|AY102636.1|
          Length = 398

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 19/64 (29%), Positives = 26/64 (40%)
 Frame = +1

Query: 28  RDFFLNHKIAVVHIYNGNNMALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAY 207
           RD F  HK    H++ G N +  PV   P  +       AS V+  A  T  +  S  A+
Sbjct: 162 RDVFAGHKYCERHMHRGRNRSRKPV-ETPTTVNATATSMASSVAAAATTTTATTTSTFAF 220

Query: 208 HDDG 219
              G
Sbjct: 221 GGGG 224


>At1g58025.1 68414.m06576 DNA-binding bromodomain-containing protein
           contains bromodomain, INTERPRO:IPR001487; contains
           prenyl group binding site (CAAX box) Prosite:PS00294
          Length = 769

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = +1

Query: 541 RNYKKHSRHHKPEHVLFACVARR 609
           +++K+H RHHK + +   CV +R
Sbjct: 340 KSHKRHGRHHKSDCMCAICVLKR 362


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,544,918
Number of Sequences: 28952
Number of extensions: 260482
Number of successful extensions: 564
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 556
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 564
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -