SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02350.1 68418.m00158 DC1 domain-containing protein contains ...    30   1.4  
At4g38730.1 68417.m05486 expressed protein                             30   1.8  
At4g09640.1 68417.m01584 expressed protein several hypothetical ...    29   4.2  
At1g31540.1 68414.m03869 disease resistance protein (TIR-NBS-LRR...    29   4.2  
At5g46270.1 68418.m05696 disease resistance protein (TIR-NBS-LRR...    28   5.6  
At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) fa...    28   5.6  
At3g23870.1 68416.m03000 permease-related low similarity to puri...    28   5.6  
At1g34470.1 68414.m04283 permease-related low similarity to puri...    28   5.6  
At5g02330.1 68418.m00156 DC1 domain-containing protein contains ...    28   7.3  
At1g71900.1 68414.m08312 expressed protein                             28   7.3  
At5g48740.1 68418.m06032 leucine-rich repeat family protein / pr...    27   9.7  
At4g13800.1 68417.m02139 permease-related contains 9 predicted t...    27   9.7  
At1g04050.1 68414.m00392 SET domain-containing protein / suppres...    27   9.7  

>At5g02350.1 68418.m00158 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 651

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +1

Query: 562 DDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITI 714
           D++++C+ C   I   +   C++     L   CA A++  +H   G  +T+
Sbjct: 388 DENIICQACILPIYEGNYYSCMDQCDFVLHEACANASRKKDHALHGHPLTL 438


>At4g38730.1 68417.m05486 expressed protein
          Length = 326

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQAVD 520
           FN  +  PI+Y  FT L   ++   I+FK  N Q  D
Sbjct: 237 FNAAIVSPIYYVMFTTL--TIVASAIMFKDWNGQNTD 271


>At4g09640.1 68417.m01584 expressed protein several hypothetical
           proteins - Arabidopsis thaliana
          Length = 386

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQA 526
           FNT V  PI+Y  FT L   ++  +I+FK  + Q+
Sbjct: 251 FNTAVVSPIYYVMFTSL--TILASVIMFKDWDRQS 283


>At1g31540.1 68414.m03869 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 776

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = -3

Query: 201 ILKLNFCNSLIEPTSTDLSINPLLN 127
           IL L FC SL+E  S+  ++N LLN
Sbjct: 655 ILNLKFCESLVELPSSIRNLNKLLN 679


>At5g46270.1 68418.m05696 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1145

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 201 ILKLNFCNSLIEPTSTDLSINPLL 130
           ILKL FC SL+E  S+  ++N LL
Sbjct: 654 ILKLGFCKSLVELPSSIRNLNKLL 677


>At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) family
            protein contains Pfam profile: PF00097 zinc finger, C3HC4
            type (RING finger)
          Length = 4706

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 5    VVSMCVDNAFA-YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFI 145
            V S+  +N FA    D LLK +S +  K  P+K Q   V ++ S+G I
Sbjct: 1644 VFSLLDENIFAGMNKDQLLKKLSNTVVKDLPYKCQKIVVTEQDSSGCI 1691


>At3g23870.1 68416.m03000 permease-related low similarity to purine
           permease [Arabidopsis thaliana] GI:7620007; contains 9
           predicted transmembrane domains; contains Pfam PF05653:
           Protein of unknown function (DUF803); identified as
           COG0697, Permeases of the drug/metabolite transporter
           (DMT) superfamily
          Length = 335

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT V  P++Y  FT     +I  +I+FK
Sbjct: 240 FNTAVISPVYYVMFT--TFTIIASMIMFK 266


>At1g34470.1 68414.m04283 permease-related low similarity to purine
           permease [Arabidopsis thaliana] GI:7620007
          Length = 368

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT V  PI+Y  FT L   ++  +I+FK
Sbjct: 251 FNTAVVSPIYYVMFTSL--TILASVIMFK 277


>At5g02330.1 68418.m00156 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 656

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/54 (20%), Positives = 26/54 (48%)
 Frame = +1

Query: 562 DDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 723
           +++++C+ C   I   +   C++  +  L   CA A++  +H      +T+  V
Sbjct: 388 NENIICQACILPIYEGNYYSCMDQCNFILHEACANASRKKDHALHSHPLTLKVV 441


>At1g71900.1 68414.m08312 expressed protein
          Length = 343

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT +  PI+Y  FT L   ++  +I+FK
Sbjct: 251 FNTAIVSPIYYVMFTSL--TILASVIMFK 277


>At5g48740.1 68418.m06032 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 895

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +2

Query: 158 DVGSISELQKFNFKINRLTSYISNI 232
           +VGS+ +LQK N   N+L S+ S +
Sbjct: 425 NVGSLKDLQKLNLSFNQLESFGSEL 449


>At4g13800.1 68417.m02139 permease-related contains 9 predicted
           transmembrane domains; contains Pfam PF05653: Protein of
           unknown function (DUF803); identified as COG0697,
           Permeases of the drug/metabolite transporter (DMT)
           superfamily
          Length = 336

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT V  P++Y  FT     ++  +I+FK
Sbjct: 240 FNTAVISPVYYVMFT--TFTILASMIMFK 266


>At1g04050.1 68414.m00392 SET domain-containing protein / suppressor
           of variegation related 1 (SUVR1) identical to suppressor
           of variegation related 1 [Arabidopsis thaliana]
           GI:15004614; contains Pfam profiles PF00856: SET domain,
           PF05033: Pre-SET motif; identical to cDNA trithorax 3
           (ATX3) partial cds GI:15217142
          Length = 630

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +2

Query: 20  VDNAFAYTTDDLLKNISFSHSKCAPFKLQNYTVLK 124
           VDN FAYT D LLK   F  ++ +  + Q   VL+
Sbjct: 377 VDNGFAYTLDGLLKE-EFLEARISEARDQRKQVLR 410


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,055,403
Number of Sequences: 28952
Number of extensions: 269189
Number of successful extensions: 711
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 696
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 711
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1604469728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -