SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g36000.1 68415.m04418 mitochondrial transcription termination...    28   5.5  
At4g22753.1 68417.m03284 sterol desaturase family protein simila...    27   9.6  

>At2g36000.1 68415.m04418 mitochondrial transcription termination
           factor-related / mTERF-related contains Pfam profile
           PF02536: mTERF
          Length = 333

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 5/79 (6%)
 Frame = -1

Query: 440 LWFYSFKHSFNVKLLPVYVYFEHSR*IEDIFKFNSCRSTSL-NFVR----ACGLGSVAIP 276
           L+ YS   ++  KL   Y+  E  R + ++ +F    S SL N ++    AC    V  P
Sbjct: 238 LFNYSIAENYEPKLK--YLMVEMGRDVREVLEFPQYFSFSLENRIKPRHEACAAKGVRFP 295

Query: 275 LILNKFTASVDLKDTLQFC 219
           L +   T     +DTL+ C
Sbjct: 296 LPVMLKTNEAGFRDTLEVC 314


>At4g22753.1 68417.m03284 sterol desaturase family protein similar
           to sterol 4-alpha-methyl-oxidase GI:16973471 from
           [Arabidopsis thaliana]; contains Pfam profile PF01598:
           Sterol desaturase
          Length = 291

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 15/52 (28%), Positives = 25/52 (48%)
 Frame = -1

Query: 191 TKIFPFSNGPKQHSLSI*IEE*DTSAMKSVFTSVLFCIRSRKGIQVPKLVVN 36
           TK+ PF  GP+ H     +     S   SVFT   +   + KG ++ K +++
Sbjct: 224 TKLIPFYGGPEYHDYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLH 275


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,982,056
Number of Sequences: 28952
Number of extensions: 299712
Number of successful extensions: 664
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 652
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 663
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1584903024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -