BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D09 (501 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 93 1e-19 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 87 5e-18 At3g49040.1 68416.m05357 F-box family protein contains F-box dom... 30 1.0 At4g28840.1 68417.m04122 expressed protein 29 1.3 At4g25020.1 68417.m03589 KOW domain-containing protein / D111/G-... 29 1.3 At3g02180.2 68416.m00193 expressed protein 29 2.3 At3g02180.1 68416.m00192 expressed protein 29 2.3 At2g23230.1 68415.m02774 terpene synthase/cyclase family protein 28 4.1 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 92.7 bits (220), Expect = 1e-19 Identities = 43/123 (34%), Positives = 69/123 (56%) Frame = +3 Query: 3 NDYISILKRLGDKYKSKMWGWIWAEAAAQPTLEEALELGGFGYPAMAVVNAKKLKFSTLR 182 N Y+ +L + DK+K +G++W A QP LE+ + +GG+GYPAM +NAKK ++ L+ Sbjct: 314 NKYLEMLLSVADKFKKDPYGFVWVAAGKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLK 373 Query: 183 GSFSETGINEFLRGLSFGRGQTAPVKGAEMPKITTTEPWDGNDGELPLEEDIDLSDVDLE 362 F + +F++ + G P+ G +I TE WDG DGE+ ++ L D+ Sbjct: 374 SGFEVKHLKDFVKEAAKGGKGNLPIDGT--MEIVKTEAWDGKDGEVVDADEFSLEDLMGN 431 Query: 363 KDE 371 DE Sbjct: 432 DDE 434 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 87.4 bits (207), Expect = 5e-18 Identities = 39/117 (33%), Positives = 67/117 (57%) Frame = +3 Query: 3 NDYISILKRLGDKYKSKMWGWIWAEAAAQPTLEEALELGGFGYPAMAVVNAKKLKFSTLR 182 N Y+ +L + +K+K + + ++W A Q LE+ + +GG+GYPAM +N KK ++ L+ Sbjct: 313 NKYLEMLLSVAEKFKKQPYSFMWVAAVTQMDLEKRVNVGGYGYPAMVAMNVKKGVYAPLK 372 Query: 183 GSFSETGINEFLRGLSFGRGQTAPVKGAEMPKITTTEPWDGNDGELPLEEDIDLSDV 353 +F + EF++ G P+ G P+I T+ WDG DGEL E++ L ++ Sbjct: 373 SAFELQHLLEFVKDAGTGGKGNVPMNGT--PEIVKTKEWDGKDGELIEEDEFSLDEL 427 >At3g49040.1 68416.m05357 F-box family protein contains F-box domain Pfam:PF00646 Length = 415 Score = 29.9 bits (64), Expect = 1.0 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 84 AQPTLEE-ALELGGFGYPAMAVVNAKKLKFSTLR 182 A P+LE +E GFGY V+NA LK+ +R Sbjct: 207 AVPSLERLTIEDSGFGYGCCYVINAPSLKYLNIR 240 >At4g28840.1 68417.m04122 expressed protein Length = 146 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 386 NSELCI-VLHSVLCYVLCACVLTCRINKLLVAVS 484 N +CI +LHS LC +C C+ T ++ +++ + Sbjct: 113 NMMVCINMLHSKLCTYICMCIFTYTVSSTMLSTN 146 >At4g25020.1 68417.m03589 KOW domain-containing protein / D111/G-patch domain-containing protein contains Pfam profiles PF01585: G-patch domain, PF00467: KOW motif Length = 375 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 186 SFSETGINE-FLRGLSFGRGQTAPVKGAEMPKITTTEPWDGNDG 314 SF G E L G + GQ +K E KI E W GN+G Sbjct: 136 SFPVDGFGEALLAGYGWKPGQGIGLKAKEDVKIVEYEKWSGNEG 179 >At3g02180.2 68416.m00193 expressed protein Length = 122 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 201 GINEFLRGLSFGRGQTAPVKGAEMPKITTTEPWDGNDG 314 G+NE G FG GQ + A M TTT DG Sbjct: 10 GVNESSLGYLFGSGQPSSAAAATMGTTTTTTTTTTTDG 47 >At3g02180.1 68416.m00192 expressed protein Length = 122 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 201 GINEFLRGLSFGRGQTAPVKGAEMPKITTTEPWDGNDG 314 G+NE G FG GQ + A M TTT DG Sbjct: 10 GVNESSLGYLFGSGQPSSAAAATMGTTTTTTTTTTTDG 47 >At2g23230.1 68415.m02774 terpene synthase/cyclase family protein Length = 611 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 69 WAEAAAQPTLEEALELGGFGYPAMAVV 149 WA A PT+EE LE+GG A + Sbjct: 433 WAAAEKVPTVEEYLEVGGVAVTMYATI 459 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,288,808 Number of Sequences: 28952 Number of extensions: 141271 Number of successful extensions: 514 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -