BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdV41007
(812 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF148962-1|AAD38952.1| 1476|Drosophila melanogaster ATP-dependen... 29 10.0
>AF148962-1|AAD38952.1| 1476|Drosophila melanogaster ATP-dependent
chromatin assemblyfactor large subunit protein.
Length = 1476
Score = 28.7 bits (61), Expect = 10.0
Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
Frame = -2
Query: 487 FSQFLKSVQNFQI--Y*FFIK-NVVMCHGLCRAQNNVYKSRITN*AVSFKFKTIKKQIQT 317
F Q +S F + FIK NV GL R + YK +TN V+F I K +
Sbjct: 179 FRQLRRSRMEFNLENLSMFIKSNVSRVDGLLRPKPEAYKQYVTNPGVNFSTIFIGKMPRY 238
Query: 316 APLK 305
+P K
Sbjct: 239 SPAK 242
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,383,247
Number of Sequences: 53049
Number of extensions: 537909
Number of successful extensions: 827
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 816
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 827
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3818998872
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -