Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40568
         (846 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    22   6.2  
AY352277-2|AAQ67419.1|   88|Apis mellifera EX4.8-5.8 protein.          22   8.2  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   8.2  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   8.2  
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    22   8.2  

>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.2 bits (45), Expect = 6.2
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +3

Query: 660 GITFYSINITLYSSVCTDFSYIF 728
           G+T Y ++I+  S V  DF+  F
Sbjct: 39  GVTMYVLSISSVSEVLMDFTLDF 61


>AY352277-2|AAQ67419.1|   88|Apis mellifera EX4.8-5.8 protein.
          Length = 88

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -2

Query: 179 PNFLPSENTTV 147
           P+F PS+NTT+
Sbjct: 23  PDFAPSKNTTI 33


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = +1

Query: 376  LVCLVIIALRWKT 414
            +V +VI+ALRW++
Sbjct: 1625 VVAVVIVALRWRS 1637


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = +1

Query: 376  LVCLVIIALRWKT 414
            +V +VI+ALRW++
Sbjct: 1621 VVAVVIVALRWRS 1633


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%)
 Frame = -2

Query: 176 NFLPSENTTVNKKCNSPTHGQSEVADFWARLYAP-TLRPVKQR 51
           N L + ++    K  SPT  +S       R+Y+P T + V +R
Sbjct: 644 NCLDASSSRRGSKIGSPTPAESTFIPEERRIYSPITFQDVARR 686


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 227,863
Number of Sequences: 438
Number of extensions: 4720
Number of successful extensions: 17
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27188448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)