BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdV40417
(718 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 26 0.41
DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 8.8
>DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride
channel protein.
Length = 383
Score = 25.8 bits (54), Expect = 0.41
Identities = 17/50 (34%), Positives = 25/50 (50%)
Frame = -2
Query: 369 QLIIIEISGGSVSLRTLATSNIISHRSLEPLQ*TYSIINIIYDCS*IHFI 220
+ I ++ G SL TLAT N S +SL P+ +I + CS F+
Sbjct: 240 EAIPARVTLGVTSLLTLATQNTQSQQSLPPVSYVKAIDVWMSSCSVFVFL 289
>DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine
receptor beta1subunit protein.
Length = 520
Score = 21.4 bits (43), Expect = 8.8
Identities = 7/13 (53%), Positives = 8/13 (61%)
Frame = +2
Query: 584 NWNFRGTKFEPRP 622
NWNFRG + P
Sbjct: 319 NWNFRGPRTHRMP 331
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,938
Number of Sequences: 438
Number of extensions: 4348
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22170330
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -