Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40407
         (669 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0575 + 5107383-5107421,5107514-5107615,5107764-5107964,510...    29   4.4  

>08_01_0575 +
           5107383-5107421,5107514-5107615,5107764-5107964,
           5108120-5108294,5108454-5108920,5109439-5109822
          Length = 455

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +2

Query: 494 NFLGTNINDIIAR*LNHDINSTPSIGNYVIGLPILV*MYTVEDRLITLRRSLKVLY 661
           N   T  + I++R   H++ ST   GNY   L ++   + V   L+  R S  V Y
Sbjct: 14  NQFATVFSSIVSRASTHEVLSTGVAGNYNGALQVMSMEFQVPSPLVPTRESYFVRY 69


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,312,853
Number of Sequences: 37544
Number of extensions: 328486
Number of successful extensions: 529
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 519
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 529
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1691314196
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)